Oxyopinin-4a Antibody

What is Oxyopinin-4a and what are its structural characteristics?

Oxyopinin-4a (Oxt-4a) is a 30-amino acid peptide isolated from the venom of the lynx spider Oxyopes takobius. Its primary structure (GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF) features a single disulfide bond between cysteine residues at positions 4 and 10, which is critical for its structural stability . Unlike other members of the oxyopinin family, Oxt-4a is unique due to this disulfide bond, reminiscent of the Rana box structure found in amphibian peptides . The peptide exhibits cationic characteristics and amphipathic properties that facilitate interactions with lipid membranes, contributing to its biological activities.

Methodology for structural characterization typically involves:

• Circular dichroism (CD) spectroscopy to determine secondary structure elements

• NMR spectroscopy in the presence of SDS micelles or lipid vesicles to obtain high-resolution structural information

• Mass spectrometry for sequence verification and confirmation of disulfide bond formation

How does Oxyopinin-4a compare with other peptides in the oxyopinin family?

Oxyopinin-4a differs significantly from other members of the oxyopinin family:

What are the primary methods for isolating and purifying Oxyopinin-4a?

Isolation and purification of Oxyopinin-4a involves multiple chromatographic steps:

• Crude venom extraction from Oxyopes takobius spiders

• Initial separation using reverse-phase high-performance liquid chromatography (RP-HPLC)

• Further purification using cation-exchange chromatography (suitable due to the peptide's cationic nature)

• Final polishing step with RP-HPLC using a C18 column

• Verification of purity using mass spectrometry

For recombinant production, the methodology involves:

• Expression in E. coli systems with N-terminal 6xHis-SUMO tags to improve solubility and enable affinity purification

• Purification using immobilized metal affinity chromatography

• Cleavage of fusion tags followed by additional chromatographic steps

• Quality assessment via SDS-PAGE (>90% purity)

What is the mechanism of action for Oxyopinin-4a's antimicrobial and cytolytic properties?

Oxyopinin-4a operates through membrane-disrupting mechanisms:

• Initial binding to bacterial or cellular membranes facilitated by electrostatic interactions between the cationic peptide and negatively charged membrane components

• Insertion into lipid bilayers due to its amphipathic nature

• Formation of non-selective ion channels or pores, causing membrane destabilization

• Subsequent cell lysis resulting from membrane disruption

The peptide shows particular affinity for phosphatidylcholine-rich membranes, similar to other oxyopinins . Electrophysiological recordings have demonstrated that oxyopinins produce a drastic reduction in cell membrane resistance by opening non-selective ion channels . The disulfide bond in Oxyopinin-4a is crucial for maintaining its conformation, enabling effective membrane interactions.

What strategies can be employed to reduce the hemolytic activity of Oxyopinin-4a while maintaining its antimicrobial properties?

Reducing hemolytic activity while preserving antimicrobial efficacy can be achieved through several research approaches:

• Structure-guided modifications: Using coarse-grained molecular dynamics simulations to identify hemolytically active fragments within the peptide, as demonstrated with Oxt-4a and latarcins . This allows for targeted mutations to reduce hemolysis.

• Peptide truncation and sequence modification: Synthesizing shorter peptides (approximately 20 residues) containing different portions of the Oxyopinin-4a sequence with specific mutations in hemolytically active regions .

• Experimental validation: Testing synthesized peptide variants through:

  • Antibacterial assays against relevant pathogens

  • Hemolytic assays using human erythrocytes

  • Membrane interaction studies using model lipid systems

Research has shown that this approach can yield peptides with substantially decreased hemolytic activity while retaining or even exceeding the antibacterial potential of parent peptides . For example, three synthesized peptides derived from Oxt-4a and latarcin-1 demonstrated significant reduction in hemolytic activity while maintaining antimicrobial efficacy .

How can molecular dynamics simulations help identify active regions of Oxyopinin-4a for targeted antibody development?

Molecular dynamics (MD) simulations provide valuable insights for antibody development against specific regions of Oxyopinin-4a:

• Coarse-grained MD simulations: Model peptide interactions with lipid bilayers mimicking erythrocyte membranes to identify key interaction regions and functional domains .

• Identification of antigenic determinants:

  • Simulate Oxyopinin-4a in physiological conditions to identify exposed epitopes

  • Analyze structural flexibility and accessibility of different peptide regions

  • Predict potential antibody binding sites based on surface characteristics

• Epitope mapping for antibody design:

  • Identify conserved vs. variable regions compared to other oxyopinins

  • Target antibodies to regions unique to Oxyopinin-4a (e.g., the region containing the disulfide bond)

  • Design antibodies that specifically recognize the native conformation maintained by the disulfide bond

• Rational antibody engineering: Use structural information to design antibodies with specific binding characteristics, potentially targeting the peptide's active sites to neutralize its hemolytic activity while preserving research utility.

This computational approach significantly accelerates antibody development by focusing experimental efforts on the most promising epitopes.

How can Oxyopinin-4a or anti-Oxyopinin-4a antibodies be utilized in cancer research, particularly related to K+ channel-expressing cells?

Oxyopinin-4a shows significant potential in cancer research targeting K+ channel-expressing tumor cells:

• Hyperpolarization-dependent cytotoxicity: Oxyopinin-4a demonstrates selective cytotoxicity to cells with hyperpolarized membrane potentials (cells expressing K+ channels) . Research shows:

  • Vulnerability correlates with resting membrane potential

  • Cells expressing Kir2.1 channels (most hyperpolarized at -80.9 mV) were most vulnerable

  • Cell death can be inhibited by K+ channel blockers

• Experimental approaches:

  • Test cytotoxicity using Cell Counting Kit-8 to measure dehydrogenase activities in living cells

  • Verify K+ channel dependency using selective blockers (e.g., Ba2+ for Kir2.1)

  • Measure membrane potential and whole-cell resistance using patch-clamp techniques

• Antibody applications:

  • Develop antibodies to study Oxyopinin-4a distribution and localization

  • Create antibodies that modulate peptide activity for controlled cytotoxicity

  • Use antibodies as targeting agents in conjunction with Oxyopinin-4a for enhanced specificity

• Gene therapy approaches: Lentiviral vectors expressing Oxyopinin-4a (Lv-Oxy) can be developed for targeted cancer therapy, showing selective cytotoxicity to K+ channel-expressing cells while sparing other cells . Pore formation can be confirmed through decreased whole-cell membrane resistance measurements.

This research direction offers promising applications for targeting cancers known to express specific K+ channels.

What methodologies are most effective for studying the interaction between Oxyopinin-4a and cellular membranes?

Multiple complementary techniques provide comprehensive understanding of Oxyopinin-4a membrane interactions:

• Biophysical approaches:

  • Circular dichroism (CD) spectroscopy: Determine conformational changes upon membrane binding

  • Surface plasmon resonance (SPR): Quantify binding kinetics to membrane models

  • Fluorescence spectroscopy: Monitor membrane penetration using labeled peptides

• Electrophysiological methods:

  • Patch-clamp recordings: Measure whole-cell resistance changes indicating pore formation

  • Planar lipid bilayer recordings: Characterize ion channel properties

  • Membrane potential measurements: Assess depolarization effects

• Microscopy techniques:

  • Confocal microscopy: Visualize peptide localization using fluorescently labeled Oxyopinin-4a

  • Atomic force microscopy: Observe membrane topographical changes

  • Cryo-electron microscopy: Visualize membrane structures at near-atomic resolution

• Molecular dynamics simulations:

  • Model peptide-membrane interactions at atomic detail

  • Determine orientation and penetration depth in lipid bilayers

  • Identify critical residues for membrane binding and disruption

• Functional assays:

  • Liposome leakage assays: Quantify membrane permeabilization

  • Hemolysis assays: Measure erythrocyte lysis at different peptide concentrations

  • Membrane depolarization assays: Monitor changes in membrane potential using voltage-sensitive dyes

Research has demonstrated that these methodologies can effectively characterize how Oxyopinin-4a interacts with and disrupts cellular membranes, providing insights into its mechanism of action .

How might recombinant expression systems be optimized for Oxyopinin-4a production for research purposes?

Optimizing recombinant expression of Oxyopinin-4a requires addressing several challenges:

• Expression system selection:

  • E. coli: Most commonly used, with established protocols for disulfide bond formation

  • Yeast systems: Potentially better for proper folding of disulfide-containing peptides

  • Cell-free systems: Avoid cytotoxicity issues during expression

• Fusion partners to enhance expression and reduce toxicity:

  • SUMO tag: Improves solubility and enables native N-terminus after cleavage

  • Thioredoxin fusion: Facilitates disulfide bond formation

  • Inclusion body targeting: Protects host cells from peptide toxicity

• Optimized expression protocol:

  • Temperature reduction during induction (15-20°C)

  • Co-expression with chaperones to assist proper folding

  • Use of specialized E. coli strains (e.g., Origami, SHuffle) engineered for disulfide bond formation

• Purification strategy:

  • Initial capture using affinity chromatography via N-terminal 6xHis tag

  • Tag removal using SUMO protease

  • Cation exchange chromatography exploiting peptide's high pI

  • Final polishing using RP-HPLC with C18 column

• Quality control methodology:

  • SDS-PAGE analysis under reducing and non-reducing conditions

  • Mass spectrometry to confirm proper disulfide bond formation

  • Functional assays to verify antimicrobial and hemolytic activities

  • Circular dichroism to confirm proper secondary structure

Current protocols have achieved greater than 90% purity using His-SUMO tagging strategies , but yield optimization remains an important research focus.

What are the challenges and solutions in developing specific antibodies against Oxyopinin-4a?

Developing specific antibodies against Oxyopinin-4a presents several challenges with corresponding solutions:

• Small size and high toxicity challenges:

  • Challenge: At only 30 amino acids, Oxyopinin-4a has limited epitopes

  • Solution: Conjugate to carrier proteins (KLH or BSA) to enhance immunogenicity while neutralizing toxicity

• Conformational epitope preservation:

  • Challenge: The disulfide bond creates unique conformational epitopes

  • Solution: Immunize with correctly folded peptide and screen antibodies using both reduced and non-reduced peptide forms

• Cross-reactivity concerns:

  • Challenge: Sequence similarity with other oxyopinins may cause cross-reactivity

  • Solution: Design immunization strategies targeting unique regions and implement extensive cross-reactivity testing against related peptides

• Antibody characterization methodology:

  • ELISA using synthetic peptide immobilized on plates

  • Western blot analysis under non-reducing conditions

  • Surface plasmon resonance (SPR) for binding kinetics determination

  • Immunoprecipitation to verify antibody specificity

• Functional antibody development:

  • Map epitopes using peptide arrays or hydrogen-deuterium exchange mass spectrometry

  • Develop neutralizing antibodies targeting functional domains

  • Create conformation-specific antibodies that distinguish between folded and unfolded states

This systematic approach addresses the significant challenges in developing highly specific antibodies against this small, toxic peptide with unique structural features.

How can combinations of Oxyopinin-4a with conventional antibiotics be leveraged for enhanced antimicrobial efficacy?

Combination therapies using Oxyopinin-4a with conventional antibiotics represent a promising research direction:

• Synergistic potential: Similar antimicrobial peptides (AMPs) have shown synergistic effects when combined with conventional antibiotics. For example, the spider venom peptide La47 showed enhanced antimicrobial activity when combined with chloramphenicol, streptomycin, and kanamycin .

• Methodology for combination studies:

  • Checkerboard assays: Determine fractional inhibitory concentration (FIC) indices

  • Time-kill assays: Assess killing kinetics of combinations versus individual agents

  • Resistance development monitoring: Evaluate whether combinations delay resistance emergence

• Mechanistic investigations:

  • Study whether Oxyopinin-4a's membrane-disrupting properties enhance antibiotic uptake

  • Investigate potential molecular interactions between the peptide and antibiotics

  • Determine if combinations target complementary cellular processes

• Case study with related peptides:
  Research on the scorpion venom peptide Css54 demonstrated that combinations with rifampicin were particularly effective against Staphylococcus aureus, while combinations with isoniazid, pyrazinamide, and ethambutol also showed inhibitory effects .

This research direction could address the growing challenge of antibiotic resistance by providing novel combination therapies with enhanced efficacy against resistant pathogens.

What is the potential of Oxyopinin-4a derivatives in selective targeting of pathogenic biofilms?

Developing Oxyopinin-4a derivatives for biofilm targeting requires specialized approaches:

• Biofilm penetration enhancement:

  • Modify Oxyopinin-4a to improve diffusion through extracellular polymeric substances

  • Engineer derivatives with reduced susceptibility to proteolytic degradation within biofilms

  • Incorporate elements that target biofilm-specific components

• Experimental methodology for biofilm studies:

  • Crystal violet assays: Quantify biofilm biomass after treatment

  • Confocal laser scanning microscopy: Visualize biofilm architecture and peptide penetration

  • Live/dead staining: Assess cellular viability within treated biofilms

  • Metabolic activity assays: Measure biofilm metabolic response to peptide treatment

• Multi-species biofilm targeting:

  • Develop derivatives with broad-spectrum activity against polymicrobial biofilms

  • Design peptides targeting conserved biofilm matrix components

  • Create peptides that disrupt quorum sensing systems

• Structure-activity relationship (SAR) studies:

  • Systematic modification of key residues to optimize biofilm activity

  • Study the impact of charge distribution on biofilm penetration and efficacy

  • Explore the role of the disulfide bond in biofilm-specific activity

This research area has significant potential for developing novel therapeutics against biofilm-associated infections, which are inherently resistant to conventional antibiotics.