PAX9 Antibody, FITC conjugated

Shipped with Ice Packs
In Stock

Description

Mechanism and Functional Role of PAX9

PAX9 is a paired box transcription factor critical for embryonic development, particularly in craniofacial structures, teeth, thymus, parathyroid glands, and skeletal elements . The FITC-conjugated antibody enables researchers to localize PAX9 expression in situ, aiding studies on:

  • Developmental biology: Tracking PAX9 during organogenesis .

  • Cancer research: Investigating PAX9’s tumor-suppressive role in cervical cancer .

  • Genetic disorders: Identifying mutations linked to tooth agenesis or skeletal dysplasia .

Comparative Analysis of PAX9 Antibodies

The FITC-conjugated PAX9 antibody differs from other variants in epitope specificity and conjugation. Below is a comparison of key antibodies:

AntibodyClone/TypeEpitopeConjugationSpecies ReactivityApplicationsSource
7C2Rat monoclonalFull-length proteinUnconjugated/HRP/PEHuman, Mouse, RatWB, IHC, IP, IF
N-terminal region (FITC)Rabbit polyclonalN-terminal peptideFITCHuman, Mouse, Rat, etc.IHC, WB, IF
3C2U5UnspecifiedN-terminal regionUnconjugatedHuman, Mouse, RatWB, IHC

The FITC variant is optimized for fluorescence-based assays, offering advantages in high-resolution imaging over non-fluorescent alternatives .

Developmental and Genetic Studies

PAX9 is essential for tooth development, with mutations causing oligodontia (congenital tooth loss). For example:

  • Nonsense mutations in PAX9’s paired domain disrupt protein function, leading to tooth agenesis .

  • RNA-seq studies revealed PAX9 regulates genes critical for craniofacial and dental morphogenesis, including those involved in epithelial-mesenchymal interactions .

Oncological Research

PAX9 acts as a tumor suppressor in cervical cancer (CC):

  • Overexpression of PAX9 inhibits CC cell proliferation and induces apoptosis via upregulation of caspase-3 and PARP .

  • Downregulation of PAX9 correlates with advanced tumor stages and poor prognosis in CC patients .

Epigenetic and Regulatory Insights

PAX9 binding sites (e.g., 5’-GCGTGACCG-3’) are enriched in promoters of developmentally regulated genes. Fluorescent antibodies like the FITC-conjugated variant enable visualization of PAX9-DNA interactions in chromatin immunoprecipitation (ChIP) assays .

Immunohistochemistry (IHC)

  1. Tissue preparation: Paraffin-embedded sections or frozen samples.

  2. Blocking: Use 5% BSA or normal serum to reduce nonspecific binding.

  3. Primary antibody: Apply PAX9-FITC (1:50–1:100 dilution) overnight at 4°C.

  4. Visualization: Direct fluorescence detection under a microscope .

Western Blot (WB)

  1. Sample preparation: Lysate from cell lines (e.g., Jurkat) or tissue homogenates.

  2. Protein separation: Resolve 30–50 µg protein on SDS-PAGE.

  3. Detection: Incubate membrane with PAX9-FITC (1:500) for 1 hour. Use FITC-compatible imaging systems .

Limitations and Considerations

  • Cross-reactivity: Ensure species-specific validation, as PAX9 homology varies (e.g., 92% in zebrafish vs. 100% in mammals) .

  • Epitope masking: Formalin-fixed paraffin-embedded (FFPE) samples may require antigen retrieval for optimal detection .

  • Signal interference: FITC’s emission spectrum (~510–540 nm) may overlap with other fluorophores; use orthogonal channels for multiplexing .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Typically, we are able to ship products within 1-3 business days following receipt of your order. Delivery time may vary depending on the shipping method or location. For specific delivery timeframes, please consult your local distributors.
Synonyms
Paired box 9 antibody; Paired box gene 9 antibody; Paired box homeotic gene 9 antibody; Paired box protein 9 antibody; Paired box protein Pax 9 antibody; Paired box protein Pax-9 antibody; Paired box protein Pax9 antibody; Paired domain gene 9 antibody; PAX 9 antibody; PAX9 antibody; PAX9_HUMAN antibody; STHAG3 antibody
Target Names
PAX9
Uniprot No.

Target Background

Function
PAX9 is a transcription factor essential for the normal development of several structures, including the thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of the skull and larynx, as well as the distal limbs.
Gene References Into Functions
  1. This study focused on the association between PAX9 mutations and the occurrence of congenitally missing teeth and/or other variations in human teeth (review). PMID: 28155232
  2. Low expression levels of PAX9 were found to be significantly associated with poor survival in patients with esophageal squamous cell carcinoma (ESCC) following surgery. This suggests that PAX9 may serve as an independent prognostic factor for ESCC patient survival. PMID: 28560390
  3. This research highlights PAX9 as a novel marker for prognostication in chronic lymphocytic leukemia. Its expression was significantly associated with a higher risk of treatment initiation, shorter time to first treatment, and overall survival. PMID: 28572861
  4. In vitro functional analysis using a PAX9 minigene construct did not demonstrate any effect on splice-site migration. Therefore, haploinsufficiency of PAX9 is proposed as the causal factor for tooth agenesis in this family. PMID: 28847717
  5. Statistically significant relationships were identified between 22 detected variations in the PAX9 gene and tooth size, with 18 of these variations being novel. PMID: 28040065
  6. The AG and GG genotypes at rs2073244 and the CC genotype at rs4904210 may strengthen the association between cytomegalovirus infection and low birth weight. PMID: 26333297
  7. These results demonstrate a novel initiation codon mutation in the PAX9 gene. This mutation is likely to have caused the oligodontia in the investigated Chinese family through haplo-insufficiency. PMID: 26571067
  8. A previously unknown heterozygous g.9527G>T mutation in the PAX9 gene was identified in monozygotic twins with oligodontia and 3 additional affected family members. This mutation is located in intron 2, specifically at the splice site between exon 2 and intron 2. PMID: 25683653
  9. A direct effect of rs12882923 and rs12883049 polymorphisms on dental agenesis was ruled out. PMID: 26707046
  10. Analysis provided evidence for gene-gene interaction between FGF3 (rs4980700) and PAX9 (rs2073242), increasing the risk for isolated oral clefts (p = 0.0003). This suggests that FGF3, which is associated with oral clefts, may interact with PAX9. PMID: 24697712
  11. The meta-analysis results identified four genetic sites in the PAX9 gene implicated in hypodontia cases. PMID: 25501211
  12. It is probable that other genes, distinct from those described in PAX9 mutations, may determine the phenotypical patterns of dental agenesis in the studied families. PMID: 24316698
  13. Polymorphisms in the promoter region of the PAX9 gene may exert an influence on the transcriptional factors and activity of this gene. PMID: 24160254
  14. This study identified novel mutations in the paired domain of PAX9 in two unrelated Japanese patients with sporadic non-syndromic oligodontia. PMID: 24436340
  15. This family study, involving an 11-year-old male proband and relatives, confirmed a frameshift mutation in a family with autosomal-dominant hypodontia. PMID: 24028587
  16. The genotype/phenotype correlation in congenital anodontia could not be verified due to the analysis of only one pedigree. PMID: 23857653
  17. Mutations in this gene have been associated with non-syndromic tooth agenesis. PMID: 22747565
  18. A family with tooth agenesis exhibited a homozygous point mutation at position 718 (G to C) in exon 3 (a nonpaired domain) of PAX9. PMID: 19641755
  19. This study identified a spontaneous novel mutation in COL1A2 (c.1171G>A; p.Gly391Ser) causing only dentin defects and a novel mutation in PAX9 (c.43T>A; p.Phe15Ile) causing hypodontia. These mutations were correlated with the phenotypic presentations within the family. PMID: 23227268
  20. Common variants in PAX9 were found to contribute to morphological variation in permanent teeth in humans. PMID: 22810112
  21. The SNP rs7142363 in the PAX9 gene contributes to nonsyndromic cleft lip/palate. PMID: 22976623
  22. Two novel missense mutations in Chinese families causing oligodontia were identified: Leu27Pro (L27P) and Ile29Thr (I29T) in the paired-domain of PAX9. Analysis of homologous PAX proteins indicated that these two substitutions may affect the function of the PAX9 protein. PMID: 22277187
  23. Reduced transcriptional activity of the novel nonsense codon mutated PAX9 protein suggested that the severe phenotype may result from haploinsufficiency of PAX9. PMID: 22058014
  24. These findings may imply that the PAX9 A240P mutation is a risk factor for oligodontia in the Chinese population. PMID: 21530942
  25. Pax9hapl a may have a protective effect against sporadic oligodontia. PMID: 22185249
  26. A novel g.-1258G>A mutation in a conserved putative regulatory element of PAX9 is associated with autosomal dominant molar hypodontia. PMID: 21443745
  27. Common variants located outside the DNA binding domain of the PAX9 gene can be related to tooth agenesis. PMID: 21111400
  28. A set of variants in PAX9 and 101 other genes related to dentition can define at least some dental morphological differences between Sub-Saharan Africans and non-Africans, potentially associated with adaptations after the modern human exodus from Africa. PMID: 21298044
  29. This study describes how the same mutation is responsible for a form of dental agenesis, with a less severe number of missing teeth, resulting in hypodontia instead of oligodontia. This highlights that mutations in the same gene can lead to different phenotypes. PMID: 21434731
  30. The 322insG mutation causes insufficient function of the PAX9 protein and haploinsufficiency, serving as a genetic model of familial non-syndromic oligodontia. PMID: 21098475
  31. A polymorphism in the PAX9 gene was detected in individuals with maxillary lateral incisor agenesis, however, its frequency was not statistically different from that in the control population. PMID: 20660504
  32. This investigation of the transcriptional activity of specific regions of the PAX9 gene promoter revealed that sequences present between -1106 and +92 are important for the expression of PAX9. PMID: 20941745
  33. Mutations in the PAX9 gene may represent polymorphisms associated with sporadic oligodontia. PMID: 20618716
  34. This case study illustrates the role of the PAX9 gene in tooth development and provides the first example of a de novo deletion of 14q13.3 manifesting primarily with oligodontia. PMID: 20485064
  35. Families with a posterior pattern of tooth agenesis showed changes in the PAX9 gene. PMID: 19816326
  36. The smaller tooth crown dimensions recorded in affected family members indicate that the effect of the PAX9 mutation is not limited to congenitally missing teeth but also extends to smaller crown size throughout the dentition. PMID: 18653171
  37. Haploinsufficiency is associated with autosomal dominant hypodontia. PMID: 11941488
  38. This report describes a case of erroneous direct sequencing, where a single nucleotide polymorphism (SNP) in the human PAX9 gene was mistyped due to allele-dependent PCR amplification. PMID: 12107448
  39. BF-1 and PAX9 interact with PLU-1 via a novel conserved sequence motif (Ala-X-Ala-Ala-X-Val-Pro-X4-Val-Pro-X8-Pro, termed the VP motif). PMID: 12657635
  40. The G151A transition might be responsible for the sporadic form of tooth agenesis. PMID: 12786960
  41. A significant reduction in PAX9 expression was observed in fetuses with Jarcho-Levin syndrome. PMID: 12833407
  42. PAX9 plays a role in tooth development in humans. PMID: 14607846
  43. A missense mutation in the paired domain of PAX9 causes non-syndromic anodontia. PMID: 14689302
  44. Mutation of the initiation codon causes oligodontia. PMID: 15615874
  45. The functional defects in DNA binding of mutant 109(InsG) PAX9 and 139(C--> T) PAX9, as well as loss-of-function of PAX9, most likely result in its haploinsufficiency during the patterning of dentition and the subsequent loss of posterior teeth. PMID: 16086281
  46. Sequencing of the PAX9 gene revealed a novel frameshift mutation and a novel missense mutation in Chinese patients with oligodontia. PMID: 16191360
  47. Mutations in PAX9 constitute a causative factor in nonsyndromic oligodontia. PMID: 16333316
  48. The Ile87Phe protein shows that both wild-type and mutant proteins are synthesized in mammalian cells and that the mutation does not alter the nuclear localization of the mutant protein in a family with molar oligodontia. PMID: 16479262
  49. Calcitonin gene expression could be directly activated by Nkx2.1, whereas Pax9 is not involved in transcription from the 2kbp calcitonin promoter. PMID: 17412341
  50. A novel nonsense mutation in PAX9 is associated with marked variability in the number of missing teeth. PMID: 17697174

Show More

Hide All

Database Links

HGNC: 8623

OMIM: 167416

KEGG: hsa:5083

STRING: 9606.ENSP00000355245

UniGene: Hs.132576

Involvement In Disease
Tooth agenesis, selective, 3 (STHAG3)
Subcellular Location
Nucleus.

Q&A

What is PAX9 and what biological processes is it involved in?

PAX9 is a transcription factor that plays crucial roles in embryonic development and cellular differentiation. It is required for normal development of the thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of the skull and larynx, as well as distal limbs . As a member of the paired box (PAX) family of transcription factors, PAX9 contains a DNA-binding domain that recognizes specific sequences to regulate gene expression. In recent research, PAX9 has been implicated in cancer progression through its interaction with the nucleosome remodeling and deacetylase (NuRD) complex, where it functions at enhancers to repress nearby gene expression . This epigenetic regulation function makes PAX9 particularly interesting in developmental biology and cancer research contexts.

What specific applications are most suitable for PAX9 antibody with FITC conjugation?

The FITC-conjugated PAX9 antibody is particularly well-suited for applications requiring direct fluorescent detection without secondary antibodies. Based on technical specifications, this antibody has been validated for immunohistochemistry (IHC) and Western blotting (WB) . The FITC conjugation (Fluorescein Isothiocyanate) makes it especially valuable for immunofluorescence microscopy, flow cytometry, and confocal imaging applications. The direct fluorescence detection eliminates potential cross-reactivity issues associated with secondary antibodies and enables cleaner multi-color immunostaining protocols. When using this antibody for fluorescence applications, researchers should implement proper controls to account for tissue autofluorescence, which can overlap with the FITC emission spectrum.

What species reactivity should researchers expect with the N-terminal PAX9 antibody?

Based on immunogen sequence homology analysis, the N-terminal region PAX9 antibody is predicted to react with multiple species including Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, and Zebrafish . The high cross-reactivity is due to the conserved nature of the N-terminal region of PAX9 across species. Specifically, the antibody's immunogen is a synthetic peptide with the sequence: LPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYN . Sequence alignment data indicates 100% homology for most mammalian species and 92% for zebrafish . This broad species reactivity makes the antibody versatile for comparative studies across model organisms, though researchers should validate reactivity in their specific experimental system before conducting full-scale experiments.

How should researchers optimize storage conditions for PAX9 antibody (FITC conjugated) to maintain its functionality?

For optimal preservation of FITC-conjugated PAX9 antibody functionality, researchers must store the antibody in light-protected vials or cover them with a light-protecting material such as aluminum foil to prevent photobleaching of the FITC fluorophore . The conjugated antibody remains stable for at least 12 months when stored at 4°C. For extended storage periods (up to 24 months), the antibody should be diluted with up to 50% glycerol and stored at -20°C to -80°C . It's important to note that repeated freezing and thawing cycles will compromise both enzyme activity and antibody binding capacity. Therefore, researchers should consider aliquoting the antibody before storage to minimize freeze-thaw cycles. Additionally, when working with the antibody, exposure to room light should be minimized during experimental procedures to prevent fluorophore degradation.

What controls are essential when using PAX9 antibody (FITC conjugated) in immunofluorescence studies?

When conducting immunofluorescence studies with FITC-conjugated PAX9 antibody, researchers should implement the following controls:

  • Positive control: Use cell lines or tissues with confirmed PAX9 expression such as Jurkat cells, which are supported by BioGPS gene expression data to express PAX9 .

  • Negative control: Include samples where PAX9 is known to be absent or use skeletal muscle tissue which shows minimal background staining compared to esophageal tissue (a PAX9-expressing tissue) .

  • Isotype control: Include a FITC-conjugated rabbit IgG (for polyclonal antibodies) with the same concentration as the PAX9 antibody to assess non-specific binding.

  • Blocking peptide control: Use the specific blocking peptide (Catalog # AAP34270) to confirm antibody specificity .

  • Autofluorescence control: Include an unstained sample to assess natural tissue autofluorescence in the FITC channel.

  • Subcellular localization verification: PAX9 should demonstrate nuclear localization consistent with its function as a transcription factor, as evident in immunofluorescence studies showing strong nuclear staining .

These controls help distinguish specific PAX9 signal from background and validate experimental findings, especially important when studying PAX9 mutations or expression changes in different biological contexts.

What dilution and detection parameters should be used for optimal results with PAX9 antibody (FITC conjugated)?

For optimal detection using PAX9 antibody (FITC conjugated), the following parameters are recommended based on technical specifications and research applications:

ApplicationRecommended DilutionBuffer CompositionIncubation ConditionsDetection Parameters
Western Blot1/10005% NFDM/TBSTOvernight at 4°CPredicted band size: 36 kDa
Immunofluorescence1/20-1/50 (20-50 μg/ml)PBS with 1% BSA1-2 hours at room temperature or overnight at 4°CFITC excitation: 495nm, emission: 519nm
Flow Cytometry1/50-1/200PBS with 0.5% BSA30-45 minutes on ice488nm laser, 530/30 bandpass filter

When analyzing the results, researchers should be aware that PAX9 exhibits nuclear localization as demonstrated in confocal imaging studies . For optimal visualization of nuclear staining, counterstaining with DAPI or another nuclear stain that doesn't overlap with FITC emission spectrum is recommended. Additionally, photobleaching should be minimized during image acquisition by using appropriate anti-fade mounting media and optimized exposure settings.

How can researchers utilize PAX9 antibody to investigate gene mutations and their functional consequences?

Researchers investigating PAX9 mutations can employ the FITC-conjugated PAX9 antibody in multiple sophisticated approaches:

  • Mutation-specific protein detection: Using site-directed mutagenesis to generate PAX9 mutants (such as R26W, R47P, I56N, and A108P) followed by transfection into relevant cell lines, researchers can employ immunofluorescence microscopy with the PAX9 antibody to assess changes in protein localization, stability, or expression levels of these mutants compared to wild-type PAX9 .

  • Functional domain analysis: The N-terminal region targeted by the antibody is critical for PAX9 function. Researchers can use the antibody to study how mutations in different domains affect protein-protein interactions, particularly with the nucleosome remodeling and deacetylase (NuRD) complex, which PAX9 interacts with to regulate enhancer activity .

  • Comparative analysis with mRNA expression: By combining immunofluorescence or Western blot detection using the PAX9 antibody with real-time PCR analysis of PAX9 mRNA (using primers such as PAX9-F: 5′-AACCAGCTGGGAGGAGTGTT-3′ and PAX9-R: 5′-TGATGTCACACGGTCGGATG-3′), researchers can investigate post-transcriptional regulation of mutant PAX9 proteins .

  • DNA binding capacity assessment: The PAX9 antibody can be used in chromatin immunoprecipitation (ChIP) assays to compare the DNA binding capacity of wild-type versus mutant PAX9 proteins, complementing gel shift analysis findings that show certain mutations (R26W, R47P, I56N, A108P, and 592delG) lead to loss of DNA binding ability .

This multi-faceted approach allows researchers to comprehensively characterize how specific mutations impact PAX9 protein function, stability, and downstream pathways.

What techniques can be combined with PAX9 immunodetection to investigate epigenetic regulation mechanisms?

To investigate PAX9's role in epigenetic regulation, researchers can employ several advanced techniques in combination with PAX9 immunodetection:

  • ChIP-seq with PAX9 antibody: This approach can identify genome-wide PAX9 binding sites, particularly at enhancer regions where PAX9 has been shown to function with the NuRD complex to repress gene expression .

  • Sequential ChIP (Re-ChIP): Using PAX9 antibody followed by antibodies against NuRD complex components can confirm co-occupancy at specific genomic loci.

  • Co-immunoprecipitation (Co-IP): PAX9 antibody can be used in IP experiments to pull down PAX9 and associated proteins, followed by Western blot analysis to detect NuRD complex components and other potential interaction partners .

  • HDAC inhibitor studies: Since PAX9 functions with the NuRD complex (which contains HDAC activity), researchers can perform immunofluorescence studies with PAX9 antibody in cells treated with HDAC inhibitors to observe changes in target gene expression or chromatin accessibility .

  • CUT&RUN or CUT&Tag: These techniques offer higher resolution than ChIP-seq and can be performed with the PAX9 antibody to map PAX9 binding sites with greater precision and lower background.

  • Proximity ligation assay (PLA): This technique can visualize and quantify interactions between PAX9 and NuRD complex components or other chromatin regulators in situ.

These combined approaches can provide mechanistic insights into how PAX9 contributes to "primed-active enhancer transition" and regulation of gene expression through epigenetic mechanisms .

How can CRISPR-based approaches be integrated with PAX9 antibody detection for functional genomics studies?

CRISPR-based approaches can be powerfully integrated with PAX9 antibody detection to conduct comprehensive functional genomics studies:

  • CRISPR knockout validation: After generating PAX9 knockout cell lines using CRISPR-Cas9 (similar to the genome-wide CRISPR screening approach described in the research literature), researchers can use the PAX9 antibody in Western blot or immunofluorescence to confirm complete loss of protein expression .

  • CRISPR knock-in of tagged PAX9: Researchers can use CRISPR to introduce epitope tags or fluorescent proteins to the endogenous PAX9 gene and verify correct tagging using the PAX9 antibody against the native protein.

  • Domain-specific mutations: CRISPR-mediated homology-directed repair can be used to introduce specific mutations in PAX9 (similar to those described in the research: R26W, R47P, I56N, and A108P) followed by immunodetection to assess protein expression and localization changes .

  • CRISPRi/CRISPRa with PAX9 antibody readout: Researchers can use CRISPRi to repress or CRISPRa to activate PAX9 expression or its target genes, then use the PAX9 antibody to quantify protein level changes and correlate with phenotypic outcomes.

  • CRISPR screens for PAX9 modulators: Similar to the genome-wide CRISPR library screening approach described in the literature, researchers can conduct screens for genes that modulate PAX9 expression or activity, using the PAX9 antibody as a readout in high-content imaging or flow cytometry .

This integration of CRISPR technology with PAX9 antibody detection enables precise genetic manipulation with protein-level validation, advancing our understanding of PAX9 biology and regulatory networks.

How should researchers address non-specific binding or background issues when using PAX9 antibody (FITC conjugated)?

When encountering non-specific binding or high background with FITC-conjugated PAX9 antibody, researchers should implement the following systematic troubleshooting approaches:

  • Optimize blocking conditions: Increase the concentration of blocking protein (BSA or normal serum) to 3-5% and extend blocking time to 1-2 hours at room temperature.

  • Validate antibody specificity: Use the specific blocking peptide (Catalog # AAP34270) in a competition assay to confirm that observed signals are specific to PAX9 .

  • Address autofluorescence: For tissues with high autofluorescence, pretreat sections with sodium borohydride (1mg/ml in PBS) for 10 minutes or use commercial autofluorescence quenching reagents.

  • Optimize fixation protocols: Overfixation can mask epitopes while underfixation may compromise tissue morphology. For the N-terminal region of PAX9, mild fixation conditions are generally preferred.

  • Titrate antibody concentration: Test a range of dilutions around the recommended 0.5 mg/ml concentration to find the optimal signal-to-noise ratio for your specific application .

  • Include additional wash steps: After antibody incubation, increase the number and duration of wash steps with 0.1% Tween-20 in PBS to remove unbound antibody.

  • Use appropriate negative controls: Always include a FITC-conjugated isotype control and ideally a PAX9-negative tissue section to distinguish true signal from non-specific binding.

For particularly challenging applications, consider using amplification methods such as tyramide signal amplification that can allow for more dilute antibody concentrations while maintaining signal intensity.

Why might researchers observe discrepancies between PAX9 protein detection and mRNA expression levels?

Discrepancies between PAX9 protein detection using antibodies and mRNA expression levels detected by PCR can occur for several biological and technical reasons:

  • Post-transcriptional regulation: Research on PAX9 has shown that mRNA stability can be affected by mutations or cellular conditions. As demonstrated in mRNA stability studies using actinomycin D treatment, wild-type and mutant PAX9 mRNA may degrade at different rates, leading to differences between mRNA and protein levels .

  • Protein stability differences: Some PAX9 mutations, particularly frameshift mutations (like 146delC, 185_189dup, 256_262dup, and 592delC) can affect protein stability without necessarily altering mRNA levels .

  • Epitope accessibility issues: The N-terminal region epitope recognized by the antibody may be masked in certain protein conformations or protein-protein interactions, resulting in underdetection of the protein despite abundant mRNA.

  • Differential detection sensitivity: qRT-PCR can detect very low copy numbers of mRNA transcripts, sometimes below the detection threshold of antibody-based protein detection methods.

  • Temporal differences: Due to delays between transcription and translation, plus differences in mRNA and protein half-lives, there may be temporal disconnects between peak mRNA and peak protein expression.

To address these discrepancies, researchers should consider conducting time-course experiments, using protein degradation inhibitors (like MG132), and employing multiple detection methods (Western blot, immunofluorescence) alongside mRNA quantification to build a comprehensive understanding of PAX9 expression regulation.

How should results be interpreted when studying PAX9 mutants using immunodetection methods?

When studying PAX9 mutants using immunodetection methods, researchers should consider the following interpretative frameworks:

  • Subcellular localization analysis: Wild-type PAX9 typically demonstrates strong nuclear localization consistent with its function as a transcription factor . Mutations may disrupt nuclear localization signals or protein folding, resulting in cytoplasmic accumulation or aggregation. Quantitative analysis of nuclear-to-cytoplasmic signal ratios across multiple cells provides objective assessment of localization defects.

  • Expression level interpretation: Some mutations may affect protein stability. Research has shown that frameshift mutations can lead to protein degradation despite normal mRNA levels . When quantifying Western blot or immunofluorescence intensity, normalize to appropriate loading controls and compare across multiple experiments.

  • Functional domain impact assessment: The N-terminal region contains part of the paired box domain critical for DNA binding. Mutations in this region (such as R26W, R47P, I56N, and A108P) have been shown to disrupt DNA binding capacity in gel shift assays . Correlate immunodetection results with functional assays like luciferase reporter activation.

  • Co-localization with interaction partners: Since PAX9 interacts with the NuRD complex to regulate gene expression , co-localization studies using the PAX9 antibody alongside antibodies against NuRD components can reveal whether mutations disrupt these protein-protein interactions.

  • Correlation with phenotypic outcomes: In the context of tooth agenesis or cancer studies, correlate immunodetection results with phenotypic data to establish genotype-phenotype relationships.

This multi-dimensional interpretation approach allows researchers to gain comprehensive insights into how specific mutations affect PAX9 protein function, potentially informing therapeutic strategies for PAX9-related disorders.

How can PAX9 antibody be utilized in cancer research and what are the key considerations?

PAX9 antibody offers valuable applications in cancer research based on recent findings about PAX9's role in cancer progression and epigenetic regulation:

  • Tumor classification and biomarker development: PAX9 expression patterns detected by immunohistochemistry can help classify tumor subtypes, particularly in small cell lung cancer (SCLC) where PAX9 has been identified as a potential oncogenic driver . Researchers should use standardized scoring systems to quantify nuclear PAX9 staining intensity and percentage of positive cells.

  • Epigenetic enhancer regulation studies: PAX9 has been shown to interact with the NuRD complex at enhancers to repress nearby gene expression, which can be reversed by HDAC inhibition . Researchers can use PAX9 antibody in ChIP-seq studies to map enhancer binding sites across different cancer types and correlate with gene expression data.

  • Therapeutic target validation: Since pharmacologic HDAC inhibition can reverse PAX9/NuRD-mediated gene repression, researchers can use PAX9 antibody to monitor protein expression and localization changes following drug treatment .

  • Cancer progression mechanisms: PAX9 antibody can be used to detect changes in protein expression during cancer progression, particularly focusing on the "primed-active enhancer transition" that results in altered expression of neural differentiation and tumor-suppressive genes .

  • Patient-derived xenograft (PDX) models: When establishing PDX models of PAX9-expressing tumors, researchers should use the antibody to confirm that PAX9 expression is maintained in the xenograft, preserving this aspect of the original tumor biology.

Key considerations include using multiple detection methods (IF, IHC, Western blot) to confirm findings, correlating with chromatin state mapping, and integrating with functional genomics approaches like CRISPR screening to identify synthetic lethal interactions with PAX9.

What advanced imaging techniques can be combined with PAX9 antibody (FITC conjugated) for developmental biology studies?

For developmental biology studies investigating PAX9 expression patterns and function, several advanced imaging techniques can be effectively combined with FITC-conjugated PAX9 antibody:

  • 3D confocal microscopy: This enables visualization of PAX9 expression patterns within the three-dimensional context of developing structures such as tooth primordia, thymus, and skeletal elements .

  • Live tissue imaging: Using explant cultures of PAX9-expressing tissues, researchers can perform time-lapse imaging to track dynamic changes in PAX9 expression during developmental processes.

  • Light-sheet fluorescence microscopy (LSFM): This technique offers reduced photobleaching and phototoxicity compared to confocal microscopy, allowing for long-term imaging of PAX9 expression in developing tissues with minimal damage.

  • Super-resolution microscopy: Techniques such as Stimulated Emission Depletion (STED) or Structured Illumination Microscopy (SIM) can resolve PAX9 localization within subnuclear structures, potentially revealing associations with specific chromatin domains.

  • Spatial transcriptomics integration: Combining immunofluorescence detection of PAX9 protein with spatial transcriptomics techniques allows researchers to correlate protein localization with transcriptional profiles across developmental tissues.

  • Correlative light and electron microscopy (CLEM): This approach enables researchers to detect PAX9 by fluorescence microscopy and then examine the ultrastructural context of PAX9-positive cells by electron microscopy.

When implementing these techniques, researchers should optimize fixation protocols to preserve both epitope accessibility and tissue architecture, and consider using spectral unmixing to distinguish FITC signal from tissue autofluorescence, particularly in developing tooth structures.

How can researchers quantitatively assess PAX9 protein-protein interactions using the FITC-conjugated antibody?

For quantitative assessment of PAX9 protein-protein interactions using FITC-conjugated antibody, researchers can employ several advanced techniques:

  • Förster Resonance Energy Transfer (FRET): When PAX9-FITC antibody (donor) is in close proximity to an acceptor fluorophore-conjugated antibody targeting a potential interaction partner (such as components of the NuRD complex), FRET can occur. This can be measured by acceptor photobleaching or fluorescence lifetime imaging microscopy (FLIM), providing quantitative data on protein proximity in situ.

  • Proximity Ligation Assay (PLA): This technique can detect interactions between PAX9 and potential partners when they are within 40nm of each other, generating quantifiable fluorescent spots. The FITC-conjugated PAX9 antibody would be used alongside an unconjugated antibody against the interaction partner, followed by appropriate PLA probes.

  • Quantitative Co-localization Analysis: Using high-resolution confocal microscopy, researchers can perform pixel-based co-localization analysis between PAX9-FITC and potential interaction partners, calculating Pearson's correlation coefficient or Manders' overlap coefficient.

  • Fluorescence Cross-Correlation Spectroscopy (FCCS): This technique can detect complex formation between PAX9 and other proteins by measuring coupled diffusion in solution or in live cells, requiring the PAX9-FITC antibody and a differently labeled antibody against the potential interaction partner.

  • Quantitative Immunoprecipitation: Using the PAX9 antibody for immunoprecipitation followed by quantitative Western blotting can provide stoichiometric information about protein complexes. The immunoprecipitation protocol should be optimized based on published methods .

These approaches provide complementary information about PAX9 interactions, from in situ detection to biochemical quantification, enabling researchers to build comprehensive models of PAX9 regulatory complexes in different biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.