PCDH11X Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to PCDH11X Antibody

PCDH11X antibodies are polyclonal rabbit IgG antibodies targeting the PCDH11X protein, encoded by the PCDH11X gene located on the X chromosome. This protein is implicated in cell-cell communication, cerebral asymmetry, and synaptic plasticity, particularly in the human brain . Antibodies against PCDH11X enable researchers to investigate its expression patterns and functional roles in health and disease.

Key Applications and Performance

PCDH11X antibodies are validated for multiple experimental techniques:

Tested Applications

ApplicationDetected In/OnRecommended DilutionCitations
Western Blot (WB)Human brain tissue1:200 – 1:1000
Immunohistochemistry (IHC)Human gliomas, brain tissue1:500 – 1:2000
Immunofluorescence (IF/ICC)HepG2 cells1:10 – 1:100
ELISAHuman samplesNot specified
  • Antigen retrieval methods (e.g., TE buffer pH 9.0 or citrate buffer pH 6.0) are recommended for optimal IHC results .

  • Reactivity includes human and mouse samples, with cross-species utility noted in mouse studies .

Physical and Chemical Properties

ParameterDetails
Host SpeciesRabbit
ClonalityPolyclonal
ImmunogenSynthetic peptide: LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS
Molecular WeightCalculated: 148 kDa; Observed: 135 kDa (WB)
Storage Conditions-20°C in PBS with 0.02% sodium azide and 50% glycerol
Purification MethodAntigen affinity chromatography
UniProt IDQ9BZA7

Functional Insights

  • PCDH11X is essential for neuronal self-avoidance and synaptic organization .

  • Dysregulation of PCDH11X has been tentatively linked to Alzheimer’s disease, though population-specific variations complicate clinical interpretations .

  • Associations with developmental dyslexia and schizoaffective disorder are under investigation, with the antibody aiding in expression profiling studies .

Experimental Validation

  • Western Blot: Detects endogenous PCDH11X in human brain lysates, confirming its role in neural tissues .

  • IHC: Highlights protein localization in gliomas, suggesting potential oncogenic or diagnostic relevance .

Limitations and Future Directions

While PCDH11X antibodies are critical for basic research, their clinical utility remains limited due to:

  1. Inconsistent associations with neurodegenerative diseases across populations .

  2. A lack of standardized protocols for novel applications like single-cell sequencing.

Ongoing studies aim to clarify its role in neurodevelopmental disorders and cancer, leveraging advanced techniques such as CRISPR-based knockout models paired with antibody validation .

Product Specs

Buffer
PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze/thaw cycles.
Lead Time
Typically, we can ship products within 1-3 business days of receiving your order. Delivery times may vary depending on the purchasing method or location. For specific delivery details, please consult your local distributors.
Synonyms
PC11X_HUMAN antibody; PCDH-X antibody; PCDH11 antibody; PCDH11X antibody; PCDHX antibody; PPP1R119 antibody; Protein phosphatase 1 regulatory subunit 119 antibody; Protocadherin 11X antibody; Protocadherin on the X chromosome antibody; Protocadherin-11 antibody; Protocadherin-11 X-linked antibody; Protocadherin-S antibody
Target Names
PCDH11X
Uniprot No.

Target Background

Function
PCDH11X is a potential calcium-dependent cell-adhesion protein.
Gene References Into Functions

PCDH11X, expressed in the brain, has been implicated in cell-cell communication, verbal ability, cerebral asymmetry, and dendritic synaptic plasticity. It has been suggested as a potential candidate gene for dyslexia.

  • PMID: 24591081 - PCDH11X is expressed in the fetal neocortex, ganglionic eminences, cerebellum, and inferior olive. In the adult brain, it is found in the cerebral cortex, hippocampal formation, cerebellum, and brain stem.
  • PMID: 22744706 - The PCDH11X/Y gene pair is believed to determine cerebral asymmetry by initiating the right shift in Homo sapiens.
  • PMID: 23600975 - Studies have not confirmed an association between PCDH11X polymorphisms and late-onset Alzheimer's disease.
  • PMID: 21276771 - No association was detected between late-onset Alzheimer disease and PCDH11X polymorphisms.
  • PMID: 20523261 - Research indicates that PCDH11X gene polymorphism does not play a major role in the genetic predisposition to late-onset Alzheimer disease in the Han Chinese population.
  • PMID: 20707987 - An association was not found for the rs5984894 polymorphism in PCDH11X in Alzheimer's disease in Italy.
  • PMID: 20555150 - Research has investigated the patterns of alternative splicing and expression of the PCDH11X/Y genes.
  • PMID: 19859901 - By confirming the suspected lack of X-Y homologous status for PCDH11 in non-human primates, findings support the hypothesis of a hominid-specific role for this gene in brain development.
  • PMID: 16825765 - A stronger case can be made for the Protocadherin11X/Y gene pair located in the hominid-specific Xq21.3/Yp11.2 region of homology, which was generated by a duplication from the X chromosome.
  • PMID: 19125366 - Genetic variation in PCDH11X is associated with susceptibility to late-onset Alzheimer's disease.
  • PMID: 19136949 - This research proposes that the PCDH11X/Y gene pair generates epigenetic diversity related to the species capacity for language, including a predisposition to psychosis.
  • PMID: 18502103 - PCDH11X is considered a candidate for the evolution of hominid-specific characteristics, including the sexual dimorphism of cerebral asymmetry, a putative correlate of language.
  • PMID: 16874762
Database Links

HGNC: 8656

OMIM: 300246

KEGG: hsa:27328

STRING: 9606.ENSP00000362186

UniGene: Hs.655673

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed strongly in fetal brain and brain (cortex, amygdala, thalamus, substantia nigra, hippocampus, caudate nucleus and corpus callosum). Expressed at low level in testis.

Q&A

What is PCDH11X and why is it significant for neuroscience research?

PCDH11X is a cell adhesion molecule belonging to the δ1-protocadherin family that has gained significant attention in neuroscience. It is present throughout mammalian evolution, while its Y-chromosome counterpart (PCDH11Y) emerged approximately 6 million years ago through a reduplicative translocation of the Xq21.3 block onto what is now human Yp11 . This creates an interesting sex difference where human females express only PCDH11X while males express both PCDH11X and PCDH11Y .

The gene pair is postulated to be critical to aspects of human brain evolution, particularly those related to the neural correlates of language . Additionally, PCDH11X plays important roles in neural development processes, including dendritic branching in developing neurons and regulation of neural stem cell differentiation and proliferation . Its expression across multiple brain regions during development suggests widespread functions in neurodevelopment, making it an important target for researchers investigating brain development, neural connectivity, and potentially neurological disorders.

Which PCDH11X antibodies are commonly used in research and how do they differ?

Several validated PCDH11X antibodies have been developed for research applications, each with distinct characteristics:

  • Procad1a: A mouse monoclonal antibody raised against a synthetic peptide [QEKNYTIREEMPE] corresponding to the N-terminus (residues 24-36) of all PCDH11X/Y variants .

  • Ex6: A mouse monoclonal antibody targeting a synthetic peptide [EVPVSVHTRPTDST] corresponding to residues 1023-1037 of the C-terminus of PCDH11Ya .

  • X11: A rabbit polyclonal antibody raised against a synthetic peptide [LHHSPPLTQATA] .

  • Anti-Pcdh11x (E-13): A commercial antibody from Santa Cruz (sc-103726) that has been successfully used for immunohistochemistry at a 1:50 dilution .

The choice between these antibodies depends on the specific research question. N-terminal antibodies like Procad1a detect all PCDH11X/Y variants, while C-terminal antibodies may be more isoform-specific. Considering the epitope location is particularly important when studying potential proteolytic processing or protein interactions that might mask certain domains.

What are the optimal protocols for PCDH11X immunostaining in brain tissue?

Based on published methodologies, here is an optimized protocol for PCDH11X immunostaining in brain tissue:

Sample preparation:

  • Fix tissue appropriately (typically 4% paraformaldehyde)

  • Section at appropriate thickness (10-14μm for immunohistochemistry)

Immunohistochemistry protocol:

  • Block sections in PBS containing 10% bovine serum albumin (BSA) and 0.3% Triton X-100 to reduce non-specific binding

  • Incubate with anti-PCDH11X primary antibody (e.g., Anti-Pcdh11x (E-13) at 1:50 dilution) overnight at 4°C

  • For chromogenic detection:

    • Apply an appropriate HRP detection system (e.g., Polink-2 plus® polymer HRP detection system for goat primary antibodies) for 30 minutes

    • Develop using DAB kit as chromogen

  • For fluorescent detection:

    • Apply appropriate fluorophore-conjugated secondary antibodies

    • Consider counterstaining with DAPI for nuclear visualization

For quantitative analysis:

  • Acquire tile-scan confocal images (1,024 × 1,024 pixels, zoom 0.75) using a 20x immersion lens (0.75 NA)

  • Measure mean gray values of PCDH11X immunostaining in regions of interest

  • Include measurement in a PCDH11X-negative area to establish baseline signal

  • Normalize measurements by subtracting this baseline signal intensity

  • Analyze multiple images per sample (at least two) for reliable quantification

When working with fluorescent reporter proteins that may interfere with PCDH11X detection, consider photobleaching sections before immunostaining to reduce background interference .

How can researchers validate the specificity of PCDH11X antibodies?

Validating antibody specificity is essential for ensuring reliable research outcomes. For PCDH11X antibodies, consider implementing these validation strategies:

  • Blocking peptide controls: Incubate the antibody with excess immunizing peptide (e.g., Pcdh11x (E-13) blocking peptide, sc-103726p) before application to tissue. Loss of signal confirms specificity to the target epitope .

  • Genetic knockout controls: Use tissue from PCDH11X knockout models as negative controls. CRISPR/Cas9-generated Pcdh11x KO samples provide definitive validation of antibody specificity .

  • Overexpression systems: Transfect cells (e.g., HEK293T) with PCDH11X expression vectors (e.g., pCAG-pcdh11x-GFP) and confirm antibody binding through immunofluorescence .

  • Multiple antibody approach: Compare staining patterns using antibodies targeting different PCDH11X epitopes (e.g., Procad1a for N-terminus, Ex6 for C-terminus) to confirm consistent localization patterns .

  • Signal attenuation in knockdown models: Verify decreased immunoreactivity in siRNA-treated or CRISPR-modified samples with reduced PCDH11X expression .

  • Western blot validation: Confirm antibody detects protein of expected molecular weight in tissue lysates, with appropriate reduction in knockout or knockdown samples.

Implementing multiple validation approaches provides the strongest evidence for antibody specificity and generates confidence in immunostaining results.

What brain regions express PCDH11X and how does expression vary developmentally?

PCDH11X shows distinct expression patterns across brain regions and developmental stages:

In human fetal brain (12-34 postconceptional weeks):

  • Strong expression in neocortex

  • Prominent labeling in ganglionic eminences

  • Clear expression in cerebellum

  • Detectable in inferior olive

In rodent brain:

  • Expression in cortex

  • Prominent in hippocampus (particularly granule cell layer, inner molecular layer, and hilus)

  • Present in ventricular/subventricular zone (VZ/SVZ)

Developmental regulation:
PCDH11X expression is dynamically regulated throughout development, with expression in neurogenic zones suggesting a role in neural progenitor regulation . The persistent expression in adult hippocampus indicates ongoing functions beyond development .

Activity-dependent regulation:
After kainate injection (an epilepsy model), PCDH11X expression changes dramatically:

  • Decreased expression in hilar cells

  • Increased expression in granule cell layer

  • Enhanced punctate signal in granule cell layer and inner molecular layer

  • Localization in ZnT3-positive mossy fiber boutons

This regional and temporal specificity of PCDH11X expression provides important context for designing experiments and interpreting results when using PCDH11X antibodies.

How can PCDH11X antibodies be employed to study neural circuit formation and plasticity?

PCDH11X antibodies offer powerful tools for investigating neural circuit development and plasticity through several methodological approaches:

  • Activity-dependent expression changes:
    PCDH11X expression is dynamically regulated by neural activity, as demonstrated in kainate-induced epilepsy models . Researchers can use PCDH11X antibodies to track experience-dependent plasticity by:

    • Comparing expression before and after behavioral training

    • Examining changes following sensory enrichment or deprivation

    • Monitoring alterations during critical developmental periods

  • Circuit-specific analysis:
    PCDH11X shows differential expression across neural circuits. In the hippocampus, for example, PCDH11X localizes to mossy fiber boutons following kainate treatment . Researchers can:

    • Combine PCDH11X immunostaining with circuit tracers

    • Use pathway-specific manipulations followed by PCDH11X immunolabeling

    • Correlate PCDH11X expression with circuit function using electrophysiology

  • Synaptic targeting mechanisms:
    PCDH11X knockout leads to altered synaptic targeting during mossy fiber sprouting, with synapses forming on granule cell somata rather than just dendrites . This finding can be leveraged to study:

    • Molecular mechanisms of target selection

    • Synapse specificity development

    • Compartment-specific synaptogenesis

  • Developmental circuit refinement:
    Given PCDH11X's role in neural development, antibodies can be used to track circuit maturation by:

    • Examining expression at multiple developmental timepoints

    • Correlating with synapse formation markers

    • Monitoring changes during pruning phases

These approaches allow researchers to understand how PCDH11X contributes to the precise wiring and modification of neural circuits throughout development and in response to experience or pathological conditions.

What methodological considerations exist when comparing PCDH11X expression between males and females?

When investigating sex differences in PCDH11X expression, researchers must address several critical methodological considerations:

  • Antibody epitope selection:

    • Most available antibodies cannot distinguish between PCDH11X and PCDH11Y proteins

    • Consider using antibodies targeting regions where amino acid sequences differ between X and Y variants if distinction is necessary

    • Validate with appropriate male and female tissue controls

  • Combined protein versus isoform-specific assessment:

    • Males express both PCDH11X and PCDH11Y, while females express only PCDH11X

    • When using pan-PCDH11X/Y antibodies, signal in males represents combined expression

    • Consider complementing protein studies with isoform-specific mRNA quantification

  • Regional analysis considerations:

    • Sex differences may be region-specific rather than global

    • Quantify expression across multiple brain regions independently

    • Use high-resolution approaches to detect potential subcellular localization differences

  • Developmental timing:

    • Sex differences may emerge at specific developmental stages

    • Design experiments with appropriate age-matched samples across development

    • Consider hormonal influences on expression, particularly during puberty

  • Quantification approaches:

    • Normalize signal appropriately, considering potential background differences

    • Use multiple methodologies (immunohistochemistry, Western blotting, qPCR)

    • Consider cell density differences when interpreting regional intensity variations

  • Statistical considerations:

    • Adequately power studies to detect potentially subtle sex differences

    • Include sex as an explicit variable in statistical analyses

    • Consider interactions between sex and other experimental variables

How can CRISPR/Cas9 genome editing be combined with PCDH11X antibodies for functional studies?

The combination of CRISPR/Cas9 genome editing with PCDH11X antibodies creates powerful experimental approaches for functional investigation:

  • In vivo knockout validation and phenotyping:

    • Design guide RNAs (gRNAs) targeting conserved regions of Pcdh11x

    • Deliver CRISPR/Cas9 components via viral vectors (e.g., AAV) to specific neural populations

    • Include reporter genes (e.g., turboRFP) in expression vectors to track transduced cells

    • Use PCDH11X antibodies to confirm knockout efficiency in targeted cells

    • Analyze morphological and functional consequences in PCDH11X-negative cells

  • Domain-specific functional analysis:

    • Design CRISPR strategies to generate domain-specific mutations rather than complete knockout

    • Use antibodies targeting different epitopes to confirm selective modification of protein domains

    • Correlate domain modifications with functional outcomes

  • Cell-type specific manipulation:

    • Restrict CRISPR/Cas9 expression to specific cell populations (e.g., using Cre-dependent systems)

    • Combine with cell-type specific markers to analyze PCDH11X function in distinct neural subtypes

    • For hippocampal studies, use Calb1 Cre/+ lines to target mature granule cells

  • Temporal control strategies:

    • Employ inducible CRISPR systems to manipulate PCDH11X at specific developmental timepoints

    • Use PCDH11X antibodies to track expression changes following induction

    • Correlate temporal manipulation with developmental or plasticity outcomes

  • Technical considerations:

    • When fluorescent reporters might interfere with immunodetection, employ strategies such as:

      • Photobleaching fluorescent proteins before immunostaining

      • Using spectral unmixing during imaging

      • Selecting compatible fluorophores for reporters and secondary antibodies

    • Validate knockout efficiency using multiple approaches:

      • Immunohistochemistry

      • Western blotting

      • RT-PCR for mRNA quantification

This integrated approach has already yielded significant insights into PCDH11X function, revealing its role in target specification during mossy fiber sprouting and granule cell organization in the hippocampus .

What is the role of PCDH11X in neural stem cell regulation and how can antibodies help elucidate this function?

PCDH11X significantly influences neural stem cell (NSC) behavior, with studies showing it decreases neural differentiation while increasing neural proliferation . PCDH11X antibodies are instrumental in understanding these functions through multiple methodological approaches:

  • Expression mapping in neurogenic niches:
    PCDH11X is expressed in key neurogenic regions including the ventricular/subventricular zone and hippocampus . Researchers can:

    • Use immunohistochemistry to map PCDH11X expression in relation to stem cell markers

    • Track developmental changes in expression within neurogenic zones

    • Compare expression patterns between active and quiescent neural stem cell populations

  • Manipulation studies combined with antibody detection:

    • Loss-of-function approaches:

      • Apply siRNA knockdown targeting PCDH11X

      • Use CRISPR/Cas9 knockout systems

      • Employ blocking antibodies against functional domains

      • Validate manipulation using PCDH11X antibodies for immunodetection

    • Gain-of-function approaches:

      • Overexpress PCDH11X using plasmid transfection (e.g., pCAG-pcdh11x-GFP)

      • Create domain-specific constructs to identify functional regions

      • Use antibodies to confirm expression and localization

  • Fate analysis of neural stem cells:

    • Combine PCDH11X immunostaining with:

      • Proliferation markers (BrdU, Ki67)

      • Neural stem cell markers (Nestin, Sox2)

      • Differentiation markers (β-III tubulin, GFAP)

    • Track cell fate decisions following PCDH11X manipulation

  • Mechanistic investigation:

    • Use co-immunoprecipitation with PCDH11X antibodies to identify binding partners

    • Examine downstream signaling pathways activated by PCDH11X

    • Investigate changes in gene expression following PCDH11X manipulation

This multi-faceted approach reveals that PCDH11X serves as a critical regulator balancing neural stem cell self-renewal versus differentiation, with potential implications for both developmental processes and adult neurogenesis in health and disease states.

How does PCDH11X contribute to mossy fiber sprouting in epilepsy models and how can antibodies track this process?

PCDH11X plays a crucial regulatory role in mossy fiber sprouting—an important pathological feature of temporal lobe epilepsy. PCDH11X antibodies have been instrumental in elucidating this function:

  • Temporal expression dynamics during epileptogenesis:
    After kainate injection (an epilepsy model):

    • PCDH11X mRNA is upregulated within 1 day

    • Protein expression increases 6-10 days after kainate, during a critical period for establishing mossy fiber target specificity

    • PCDH11X antibodies enable tracking of this dynamic expression pattern

  • Spatial localization during mossy fiber reorganization:
    PCDH11X antibodies reveal specific localization patterns:

    • Prominent punctate PCDH11X signal appears in granule cell layer (GCL) and inner molecular layer (IML)

    • PCDH11X localizes to somato-dendritic domains of granule cells

    • Co-localization with ZnT3 (a mossy fiber marker) shows PCDH11X presence in mossy fiber boutons in IML and GCL

  • Functional analysis through knockout studies:
    CRISPR/Cas9-mediated PCDH11X knockout (Pcdh11x KO+KA) compared to controls (Pcdh11x Control+KA) reveals:

    • Increased granule cell dispersion

    • Altered synaptic targeting with more mossy fiber synapses on granule cell somata

    • Approximately 50% more ZnT3+ puncta in the granule cell layer

    • These phenotypes can be quantified using PCDH11X and ZnT3 antibodies

  • Methodological approach for tracking mossy fiber sprouting:

    • Induce epilepsy-like activity using kainate injection

    • Apply PCDH11X antibodies at various timepoints post-injection

    • Co-label with ZnT3 antibodies to identify mossy fiber terminals

    • Quantify signal intensity across hippocampal layers (hilus, GCL, IML, MML/OML)

    • Compare wildtype versus PCDH11X knockout conditions

These findings collectively demonstrate that PCDH11X acts as a molecular regulator of synaptic target selection during reactive synaptogenesis, controlling where new synapses form during mossy fiber sprouting. This understanding could inform potential therapeutic strategies for epilepsy.

What technical challenges exist when performing co-labeling studies with PCDH11X antibodies and how can they be overcome?

Co-labeling studies with PCDH11X antibodies present several technical challenges that require specific methodological solutions:

  • Fluorophore interference challenges:
    When combining PCDH11X immunostaining with fluorescent reporters (e.g., tRFP):

    • Signal cross-bleed between channels can occur, particularly in strongly labeled structures

    • Solution approach:

      • Photobleach sections by exposing them to light for several hours before PCDH11X immunostaining

      • Use spectral unmixing during image acquisition

      • Apply careful normalization strategies for signal quantification

  • Antibody compatibility issues:
    When using multiple primary antibodies:

    • Host species conflicts may occur (many PCDH11X antibodies are mouse or rabbit-derived)

    • Solution approach:

      • Use directly conjugated primary antibodies

      • Employ sequential immunostaining protocols with intermediate fixation

      • Consider using Fab fragments to prevent cross-reactivity

  • Signal intensity differences:
    PCDH11X expression levels vary across brain regions and experimental conditions:

    • Low expression in control conditions may be difficult to distinguish from background

    • Solution approach:

      • Establish proper baseline signal in PCDH11X-negative regions

      • Normalize PCDH11X signal intensity by subtracting this baseline

      • Use signal amplification methods for detecting low-level expression

  • Epitope masking concerns:
    Protein interactions or conformational changes may block antibody binding sites:

    • Solution approach:

      • Test multiple antibodies targeting different PCDH11X epitopes

      • Optimize antigen retrieval methods

      • Consider mild fixation conditions to preserve epitope accessibility

  • Quantitative co-localization analysis:
    Accurately measuring co-localization between PCDH11X and other markers:

    • Solution approach:

      • Use high-resolution imaging (confocal or super-resolution microscopy)

      • Apply appropriate co-localization algorithms and statistics

      • Establish clear thresholds for defining positive signals

By addressing these technical challenges with appropriate methodological solutions, researchers can effectively perform co-labeling studies to explore PCDH11X interactions with other cellular components and molecular markers.

How can single-cell techniques be combined with PCDH11X antibodies to understand cell-type specific functions?

Integrating single-cell approaches with PCDH11X antibodies enables precise analysis of cell-type specific expression and function:

  • Single-cell isolation followed by immunocytochemistry:

    • Dissociate brain tissue into single cells using enzymatic digestion

    • Perform PCDH11X immunostaining on isolated cells

    • Combine with cell-type specific markers to identify expressing populations

    • Quantify expression levels across cell types and developmental stages

  • Patch-clamp electrophysiology with post-hoc immunostaining:

    • Record electrophysiological properties from individual neurons

    • Fill recorded cells with biocytin or fluorescent dyes

    • Perform post-hoc PCDH11X immunostaining

    • Correlate PCDH11X expression with functional properties

    • This approach has revealed that PCDH11X knockout affects granule cell dispersion while preserving basic electrophysiological properties

  • Fluorescence-activated cell sorting (FACS) with PCDH11X antibodies:

    • For surface-expressed PCDH11X, use live-cell labeling with non-permeabilizing conditions

    • For total PCDH11X, fix and permeabilize cells before antibody application

    • Sort PCDH11X-positive versus negative populations

    • Perform downstream molecular analyses (RNA-seq, proteomics) on sorted populations

  • Single-cell RNA sequencing complemented by antibody validation:

    • Perform scRNA-seq to identify cell populations expressing Pcdh11x mRNA

    • Validate protein expression in identified populations using PCDH11X antibodies

    • Correlate transcriptomic profiles with protein expression patterns

  • Spatial transcriptomics combined with immunohistochemistry:

    • Apply spatial transcriptomics methods to map Pcdh11x mRNA distribution

    • Perform PCDH11X immunostaining on adjacent sections

    • Integrate spatial mRNA and protein data to understand translational regulation

  • In vivo cell-type specific manipulation with antibody validation:

    • Use cell-type specific Cre lines for targeted PCDH11X manipulation

    • Employ PCDH11X antibodies to confirm cell-type specific knockout or overexpression

    • Analyze functional consequences in manipulated cell populations

These integrated approaches allow researchers to move beyond bulk tissue analysis and understand how PCDH11X expression and function varies across neural cell types, potentially revealing cell-type specific roles in development, circuit formation, and disease processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.