PCNXL2 Antibody

Shipped with Ice Packs
In Stock

Product Specs

Buffer
The antibody is provided in PBS buffer containing 0.02% Sodium Azide, 50% Glycerol, at pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
We typically dispatch orders within 1-3 business days of receipt. Delivery times may vary depending on the purchasing method and location. For specific delivery information, please contact your local distributors.
Synonyms
FLJ11383 antibody; KIAA0435 antibody; Pcnxl2 antibody; PCX2_HUMAN antibody; Pecanex-like protein 2 antibody
Target Names
PCNX2
Uniprot No.

Target Background

Function
PCNXL2 may play a role in the development of colorectal carcinomas with high microsatellite instability (MSI-H).
Gene References Into Functions
  1. Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability. PMID: 12140758
Database Links

HGNC: 8736

OMIM: 617656

KEGG: hsa:80003

UniGene: Hs.370605

Protein Families
Pecanex family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PCNXL2 and why is it significant in cancer research?

PCNXL2 (pecanex-like protein 2) is a protein that has been identified as potentially playing a significant role in the tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H) . The gene is also known by several aliases including FLJ11383, KIAA0435, and PCX2_HUMAN . Recent in silico studies have suggested it may have tumor suppressor functionality, making it an important target for cancer research . Understanding PCNXL2's function requires reliable antibodies for detection and characterization in various experimental contexts.

What types of PCNXL2 antibodies are currently available for research?

Currently, commercially available PCNXL2 antibodies primarily consist of rabbit polyclonal antibodies. These antibodies are targeted against human PCNXL2 and are available in liquid format . The most commonly used antibodies include:

Antibody TypeHostFormatApplicationsReactivityImmunogen
Polyclonal PrimaryRabbitLiquidELISA, Western BlottingHumanHuman PCNXL2
PolyclonalRabbitAffinity PurifiedIHC, IHC-ParaffinHumanRecombinant Protein (SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA)

When selecting an antibody, researchers should consider the specific application needs and validate the antibody's performance in their experimental system.

How should PCNXL2 antibodies be stored to maintain their activity?

For optimal stability and activity preservation, PCNXL2 antibodies should be stored at 4°C for short-term use (days to weeks). For long-term storage, antibodies should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C . This approach minimizes protein denaturation that can occur during repeated freezing and thawing. Most commercially available PCNXL2 antibodies are supplied in PBS (pH 7.2) with 40% Glycerol and 0.02% Sodium Azide as preservative . When handling the antibody, it's advisable to use sterile techniques and minimize exposure to room temperature.

What are the recommended dilutions for PCNXL2 antibodies in different applications?

The optimal dilution for PCNXL2 antibodies varies depending on the specific application and the antibody concentration. Based on available data, the following dilutions are recommended:

ApplicationRecommended Dilution RangeNotes
Western BlottingConcentration-dependentValidation required for each lot
ELISAConcentration-dependentValidation required for each lot
Immunohistochemistry (IHC)1:20 - 1:50 For paraffin-embedded sections

It's important to note that these are starting points, and researchers should perform dilution series experiments to determine the optimal concentration for their specific samples and experimental conditions. Signal-to-noise ratio assessment is critical when optimizing antibody dilutions.

How can I validate the specificity of a PCNXL2 antibody for my research?

Validating antibody specificity is crucial for reliable experimental results. For PCNXL2 antibodies, consider these validation methods:

  • Positive and negative control samples: Use tissues or cell lines known to express or not express PCNXL2.

  • Knockdown/knockout validation: Compare staining in wild-type vs. PCNXL2 knockdown/knockout samples.

  • Peptide competition assay: Pre-incubate the antibody with the immunizing peptide to block specific binding.

  • Multiple antibody comparison: Use antibodies recognizing different epitopes of PCNXL2.

  • Cross-reactivity assessment: Some PCNXL2 antibodies have been verified on protein arrays containing the target protein plus 383 other non-specific proteins to ensure specificity .

Documentation of antibody validation should include images of Western blots or immunostaining with appropriate molecular weight markers and controls.

What cell lines are recommended for studying PCNXL2 expression patterns?

Based on the known association of PCNXL2 with colorectal carcinomas with high microsatellite instability (MSI-H) , the following cell lines are recommended for studying PCNXL2 expression:

Cell Line TypeRecommended LinesCharacteristics
Colorectal CancerHCT116, RKO, LoVoMSI-H status
Control LinesSW480, HT29Microsatellite stable
Normal ColonCCD-18CoNormal colon fibroblasts

When using these cell lines, it's important to verify their authentication and mycoplasma-free status. Additionally, researchers should consider studying PCNXL2 expression across a panel of cell lines representing different tissue types to gain insights into its tissue-specific expression patterns.

How can I optimize immunohistochemistry protocols for PCNXL2 detection in paraffin-embedded tissues?

Optimizing immunohistochemistry (IHC) for PCNXL2 detection requires attention to several critical parameters:

  • Antigen retrieval: For PCNXL2, heat-induced epitope retrieval in citrate buffer (pH 6.0) is typically effective, but compare with EDTA buffer (pH 9.0) to determine optimal conditions.

  • Blocking conditions: Use 5-10% normal serum from the same species as the secondary antibody for 1 hour at room temperature.

  • Antibody incubation: For PCNXL2 antibodies, dilutions of 1:20 - 1:50 are recommended . Primary antibody incubation at 4°C overnight often yields better results than shorter incubations.

  • Detection system: Use a detection system appropriate for your microscopy setup - chromogenic (DAB) or fluorescent.

  • Counterstaining: Hematoxylin counterstaining helps visualize tissue architecture.

Always include positive and negative controls, and consider dual staining with markers of subcellular compartments to confirm localization patterns.

What approaches can be used to study PCNXL2 protein-protein interactions?

Investigating PCNXL2 protein-protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Use PCNXL2 antibodies to pull down PCNXL2 and its binding partners, followed by mass spectrometry or Western blotting for suspected interactors.

  • Proximity ligation assay (PLA): Allows visualization of protein interactions in situ with subcellular resolution.

  • Yeast two-hybrid screening: Useful for identifying novel interaction partners.

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in living cells.

  • Cross-linking mass spectrometry: Provides structural information about interaction surfaces.

For PCNXL2 specifically, investigating interactions with proteins involved in microsatellite instability pathways would be particularly relevant given its potential role in MSI-H colorectal carcinomas .

How can computational methods complement experimental approaches in PCNXL2 antibody research?

Computational methods can significantly enhance experimental research on PCNXL2:

  • Epitope prediction: In silico tools can predict antigenic regions of PCNXL2, helping to design more specific antibodies.

  • Sequence-based antibody design: Recent advances like DyAb allow for sequence-based antibody design and property prediction even with limited training data .

  • Structural modeling: Predicting PCNXL2 protein structure can inform antibody binding sites and function.

  • Cross-reactivity prediction: Computational tools can assess potential cross-reactivity with other proteins.

  • Property optimization: Methods like those described in recent research can optimize antibody properties such as affinity, using genetic algorithms to improve binding .

For example, researchers have successfully employed computational approaches to design antibodies with improved binding affinities, achieving up to 50-fold improvements in some cases . These methods could be applied to develop better PCNXL2-targeting antibodies.

What are common causes of false positives or false negatives when using PCNXL2 antibodies?

When working with PCNXL2 antibodies, several factors can lead to misleading results:

Causes of False Positives:

  • Cross-reactivity: Polyclonal antibodies may recognize proteins with similar epitopes.

  • Inadequate blocking: Insufficient blocking can lead to non-specific binding.

  • Secondary antibody issues: Cross-reactivity of secondary antibodies with endogenous immunoglobulins.

  • Endogenous peroxidase/phosphatase activity: Incomplete quenching can cause background in enzymatic detection systems.

Causes of False Negatives:

  • Epitope masking: Fixation or processing may alter the epitope recognized by the antibody.

  • Suboptimal antigen retrieval: PCNXL2 epitopes may require specific retrieval conditions.

  • Antibody degradation: Improper storage can reduce antibody activity.

  • Low expression levels: PCNXL2 may be expressed at levels below detection threshold.

To mitigate these issues, always include appropriate positive and negative controls, and validate antibodies thoroughly before experimental use.

How should contradictory results between different detection methods for PCNXL2 be reconciled?

When faced with contradictory results between different methods (e.g., IHC shows expression but Western blot does not):

  • Consider epitope accessibility: Different methods expose different epitopes. The antibody might recognize a conformation-dependent epitope present only in certain techniques.

  • Evaluate method sensitivity: Western blotting and IHC have different detection thresholds.

  • Check antibody validation: Ensure the antibody has been validated for all applications in which it's being used.

  • Examine post-translational modifications: Some antibodies may recognize only certain modified forms of PCNXL2.

  • Use multiple antibodies: Employ antibodies targeting different epitopes to confirm results.

  • Implement orthogonal methods: Use mRNA detection (qPCR, RNA-seq) to correlate with protein detection.

Document all experimental conditions meticulously when reporting contradictory results, as subtle differences in protocol may explain discrepancies.

What statistical approaches are recommended for quantifying PCNXL2 expression in tissue microarrays?

For rigorous quantification of PCNXL2 expression in tissue microarrays:

  • Scoring systems: Develop a standardized scoring system (e.g., H-score = intensity × percentage of positive cells).

  • Digital image analysis: Use software for unbiased quantification of staining intensity and distribution.

  • Multi-observer assessment: Have at least two blinded observers score samples independently.

  • Statistical tests:

    • For comparing expression between two groups: Student's t-test or Mann-Whitney U test

    • For multiple groups: ANOVA or Kruskal-Wallis test

    • For correlation with clinical variables: Spearman or Pearson correlation

    • For survival analysis: Kaplan-Meier with log-rank test and Cox regression

  • Power analysis: Ensure sufficient sample size for statistical significance, particularly given the potential heterogeneity of PCNXL2 expression.

Always report both the scoring method and statistical approach in detail to enable reproduction of results.

How might PCNXL2 antibodies be incorporated into larger-scale proteomic studies?

PCNXL2 antibodies can be valuable tools in proteomic research through:

  • Antibody arrays: Including PCNXL2 antibodies in panels targeting cancer-associated proteins for multiplex analysis.

  • Immunoprecipitation-mass spectrometry (IP-MS): Pulling down PCNXL2 and its interacting partners for identification.

  • Reverse phase protein arrays (RPPA): High-throughput analysis of PCNXL2 expression across many samples simultaneously.

  • Single-cell proteomics: Examining PCNXL2 expression heterogeneity within tumors at single-cell resolution.

  • Phospho-proteomic integration: Correlating PCNXL2 expression with phosphorylation states of signaling pathways.

These approaches could help elucidate PCNXL2's role in protein networks relevant to colorectal carcinogenesis and potentially identify new therapeutic targets in the PCNXL2 pathway.

What are promising approaches for improving PCNXL2 antibody specificity and affinity?

Recent advances in antibody engineering offer promising approaches for developing better PCNXL2 antibodies:

  • Machine learning-guided design: Tools like DyAb can predict antibody properties and guide design even with limited training data .

  • Genetic algorithm optimization: Starting with known affinity-enhancing mutations and using genetic algorithms to design novel combinations can significantly improve antibody binding, with some studies showing up to 50-fold improvements in affinity .

  • Single B-cell cloning: Isolating B-cells producing PCNXL2 antibodies for deriving high-affinity monoclonal antibodies.

  • Phage display: Screening large antibody libraries for high-specificity PCNXL2 binders.

  • Structure-guided design: Using structural information about PCNXL2 epitopes to optimize complementarity-determining regions (CDRs).

The DyAb approach has shown particular promise, generating antibodies with high binding rates (85-89%) and significant affinity improvements across multiple targets .

How might understanding PCNXL2's role as a potential tumor suppressor influence antibody-based therapeutic approaches?

If further research confirms PCNXL2's hypothesized tumor suppressor role , this would significantly impact antibody-based therapeutic strategies:

  • Diagnostic applications: PCNXL2 antibodies could be developed for identifying tumors with PCNXL2 loss/mutation.

  • Functional rescue approaches: Rather than targeting PCNXL2 directly, therapies might target pathways activated by PCNXL2 loss.

  • Combinatorial biomarker panels: PCNXL2 status could be incorporated into panels predicting response to specific therapies.

  • Synthetic lethality: Identifying dependencies created by PCNXL2 loss could reveal new therapeutic targets.

  • Gene therapy monitoring: Antibodies could be used to monitor PCNXL2 restoration in experimental gene therapy approaches.

This understanding would shift research focus from simple detection to functional characterization of PCNXL2 and its interacting partners in the context of MSI-H colorectal carcinomas .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.