PDZK1 antibodies are immunological reagents specifically designed to detect and bind to PDZK1 protein in various experimental applications. These antibodies recognize specific epitopes on the PDZK1 protein, enabling researchers to study its expression, localization, and interactions within cells and tissues. PDZK1 antibodies are available in different forms, including monoclonal and polyclonal variants, each produced in specific host animals and optimized for various research techniques .
The development of these antibodies has been instrumental in advancing our understanding of PDZK1's biological functions, particularly its role in cellular signaling networks and disease processes. Through the use of these specialized immunological tools, researchers can visualize, quantify, and isolate PDZK1 protein from complex biological samples, providing critical insights into its molecular mechanisms and pathological implications .
PDZK1 antibodies have gained increasing importance due to mounting evidence that PDZK1 plays significant roles in cancer biology, drug resistance mechanisms, and membrane transport processes. These antibodies allow for precise detection of PDZK1 in both normal physiological contexts and disease states, making them invaluable resources for advancing biomedical research and potential therapeutic development .
The PDZK1 Antibody (F-36) exemplifies monoclonal antibodies in this category. It is a mouse monoclonal IgG1 kappa light chain antibody specifically designed to detect PDZK1 of human origin. Available in non-conjugated form, this antibody enables versatile applications across multiple experimental platforms. The monoclonal nature ensures high specificity and reproducibility in detecting the target protein .
Key specifications for this antibody include:
| Characteristic | Description |
|---|---|
| Clone | F-36 |
| Host | Mouse |
| Isotype | IgG1 kappa light chain |
| Target Species | Human |
| Reactivity | Human origin PDZK1 |
| Format | Non-conjugated |
| Catalog Number | sc-100337 |
| Unit Size | 50 μg/0.5 ml |
This monoclonal antibody is particularly valuable for experiments requiring high specificity and consistent performance across multiple assays .
Polyclonal anti-PDZK1 antibodies, such as those produced in rabbits by Sigma-Aldrich, offer complementary advantages to their monoclonal counterparts. These affinity-isolated antibodies recognize multiple epitopes on the PDZK1 protein, potentially providing enhanced sensitivity for detection applications .
Key specifications include:
| Characteristic | Description |
|---|---|
| Type | Polyclonal |
| Host | Rabbit |
| Format | Buffered aqueous glycerol solution |
| Target Species | Human, mouse, rat |
| Enhanced Validation | RNAi knockdown, orthogonal RNAseq |
| Immunogen Sequence | MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAV |
| Storage | -20°C |
These polyclonal antibodies have been validated through advanced techniques including RNAi knockdown and orthogonal RNAseq, ensuring their specificity and reliability for research applications .
Understanding the biological functions of PDZK1 is essential for comprehending the significance of PDZK1 antibodies in research. PDZK1 serves as a critical adaptor protein involved in multiple cellular processes and signaling pathways.
PDZK1 engages in direct protein interactions with multiple binding partners. Notably, it interacts with Epidermal Growth Factor Receptor (EGFR), influencing EGFR signaling pathways through multiple mechanisms. Research has demonstrated that PDZK1 promotes EGFR degradation by enhancing the binding of EGFR to c-Cbl and inhibits EGFR phosphorylation by hindering EGFR dimerization .
Additionally, PDZK1 has been shown to interact with Organic Anion Transporting Polypeptide 1A2 (OATP1A2) through direct binding to its C-terminal PDZ binding domain. This interaction has functional consequences, as co-expression of PDZK1 with OATP1A2 activates the transporter function by increasing its expression at the plasma membrane and decreasing clathrin-mediated internalization .
These molecular interactions illustrate PDZK1's central role in coordinating membrane protein trafficking, stability, and function—processes that are fundamental to cellular physiology and that may be dysregulated in disease states .
PDZK1 antibodies serve as versatile tools across multiple experimental techniques, enabling researchers to investigate PDZK1's expression, localization, interactions, and functional roles in both normal and pathological contexts.
Both monoclonal and polyclonal PDZK1 antibodies support a wide range of immunodetection applications:
Western Blotting (WB): PDZK1 antibodies enable protein detection and quantification in cell and tissue lysates. The recommended concentration for polyclonal anti-PDZK1 antibodies in immunoblotting is 0.04-0.4 μg/mL, allowing for sensitive detection of the target protein .
Immunoprecipitation (IP): These antibodies can isolate PDZK1 and its associated protein complexes from biological samples, facilitating the study of protein-protein interactions. This application has been instrumental in demonstrating PDZK1's interactions with proteins like EGFR and OATP1A2 .
Immunofluorescence (IF): With recommended concentrations of 0.25-2 μg/mL for polyclonal antibodies, PDZK1 antibodies allow for visualization of the protein's subcellular localization through fluorescence microscopy .
Immunohistochemistry (IHC): Particularly useful for paraffin-embedded tissue sections, PDZK1 antibodies (recommended dilution of 1:500-1:1000 for polyclonal variants) enable the assessment of PDZK1 expression patterns in tissues from normal and disease states .
Enzyme-Linked Immunosorbent Assay (ELISA): PDZK1 antibodies can be employed in quantitative assays to measure PDZK1 protein levels in biological fluids and cell lysates .
PDZK1 antibodies have been particularly valuable in cancer research models, especially those focused on triple-negative breast cancer (TNBC). They have enabled researchers to:
Assess PDZK1 expression levels in clinical samples, revealing its downregulation in TNBC tissues compared to normal breast tissue .
Investigate correlations between PDZK1 expression and patient prognosis, identifying PDZK1 as a significant prognostic factor in TNBC .
Study the relationship between PDZK1 levels and drug sensitivity, particularly in the context of erlotinib resistance in TNBC .
Examine PDZK1's role in protein transport and drug resistance mechanisms, contributing to our understanding of multidrug resistance in human carcinomas of epithelial origin .
These applications demonstrate how PDZK1 antibodies serve as critical tools for advancing our understanding of PDZK1's roles in both normal physiology and disease states .
Effective utilization of PDZK1 antibodies requires adherence to specific technical guidelines to ensure optimal results across different experimental applications.
Different experimental techniques require specific antibody concentrations for optimal results:
| Technique | Recommended Concentration/Dilution |
|---|---|
| Immunoblotting (Western Blot) | 0.04-0.4 μg/mL |
| Immunofluorescence | 0.25-2 μg/mL |
| Immunohistochemistry | 1:500-1:1000 dilution |
| Immunoprecipitation | Variable based on protein expression levels |
| ELISA | Variable based on assay design |
These recommendations ensure sufficient sensitivity while minimizing background signal in respective applications .
PDZK1 antibodies undergo rigorous validation to ensure specificity and reliability:
RNAi Knockdown: Confirmation that antibody signal decreases when PDZK1 is knocked down using RNA interference techniques .
Orthogonal RNAseq: Correlation of antibody signal with PDZK1 mRNA expression levels determined by RNA sequencing .
Cross-Reactivity Testing: Evaluation of species reactivity, with confirmed detection in human, mouse, and rat samples for certain antibodies .
These validation approaches provide researchers with confidence in the specificity and reliability of PDZK1 antibodies for their experimental applications.
PDZK1 antibodies have been instrumental in elucidating PDZK1's significant roles in cancer biology, particularly in the context of triple-negative breast cancer (TNBC).
Research utilizing PDZK1 antibodies for immunohistochemical analysis has revealed that PDZK1 is specifically downregulated in TNBC tissues compared to normal breast tissue and non-TNBC breast cancer subtypes. This pattern of expression suggests a potential tumor-suppressive role specific to TNBC .
The correlation between PDZK1 expression and clinical outcomes has been thoroughly investigated. Lower PDZK1 levels in TNBC tissues correlate with poor prognosis in TNBC patients, indicating its potential utility as a prognostic biomarker. Importantly, these correlations were not detected in the entire breast cancer patient cohort or in non-TNBC patients, highlighting the specificity of PDZK1's role in TNBC development .
Functional studies employing PDZK1 antibodies have established PDZK1 as a novel tumor suppressor specific for TNBC. Experimental manipulation of PDZK1 expression has demonstrated that:
Overexpression of PDZK1 inhibits TNBC cell malignancy in vitro, reducing proliferation, migration, and other hallmarks of cancer progression .
Knockdown of PDZK1 markedly enhances TNBC cell malignancy in vitro, promoting proliferation and other aspects of tumor cell behavior .
In vivo models show that PDZK1 knockdown promotes the proliferation of TNBC cells, confirming its tumor-suppressive function in physiologically relevant contexts .
These findings collectively establish PDZK1 as a significant tumor suppressor in TNBC, with potential implications for therapeutic strategies targeting this aggressive breast cancer subtype .
PDZK1 antibodies have been pivotal in uncovering the relationship between PDZK1 expression and sensitivity to targeted therapies in TNBC. Investigation of PDZK1 levels in different breast cancer cell lines revealed that PDZK1 is downregulated in erlotinib-resistant TNBC cells compared to erlotinib-sensitive or moderately sensitive TNBC cells .
This correlation extends to therapeutic implications, as:
PDZK1 overexpression sensitizes TNBC cells to erlotinib both in vitro and in vivo, suggesting its potential as a molecular therapeutic target for reversing erlotinib resistance .
The mechanism involves PDZK1's regulation of EGFR signaling, as PDZK1 promotes EGFR degradation and inhibits EGFR phosphorylation through direct interaction with the receptor .
These findings highlight PDZK1's significance not only as a prognostic factor but also as a potential therapeutic target for improving response to EGFR-targeted therapies in TNBC .
PDZK1 antibodies have facilitated detailed investigations into the molecular mechanisms underlying PDZK1's functions, particularly its interactions with various binding partners and its effects on signaling pathways.
Co-immunoprecipitation experiments using PDZK1 antibodies have demonstrated that PDZK1 physically binds to EGFR. This interaction has functional consequences for EGFR signaling and stability :
PDZK1 promotes EGFR degradation by enhancing the binding of EGFR to c-Cbl, a ubiquitin ligase that targets proteins for degradation .
PDZK1 inhibits EGFR phosphorylation by hindering EGFR dimerization, a critical step in receptor activation and downstream signaling .
Gene set enrichment analysis (GSEA) has shown that PDZK1 levels are negatively correlated with EGFR signaling activation in TNBC samples, with low PDZK1 expression associated with enhanced EGFR pathway activation .
These mechanisms collectively contribute to PDZK1's role in suppressing EGFR-mediated signaling pathways that promote cancer progression .
PDZK1 antibodies have also been instrumental in characterizing PDZK1's interaction with OATP1A2, an organic anion transporting polypeptide involved in drug transport. Co-immunoprecipitation experiments have confirmed that PDZK1 directly interacts with OATP1A2 through the putative PDZ binding domain located within the C-terminus of the transporter .
This interaction has functional implications:
Co-expression of PDZK1 activates OATP1A2 function through direct interaction with its PDZ binding domain .
The enhanced function of OATP1A2 is due to increased protein expression at the plasma membrane following decreased clathrin-mediated internalization .
These findings illustrate PDZK1's role in regulating membrane transporters, which has implications for drug disposition and potentially for therapeutic responses in various disease contexts .
The continued development and application of PDZK1 antibodies will likely expand our understanding of PDZK1 biology and its therapeutic implications.
Based on current research findings, several promising therapeutic directions emerge:
PDZK1 as a Biomarker: PDZK1 antibodies could be developed for diagnostic applications to assess PDZK1 expression levels in TNBC patients, potentially guiding treatment decisions regarding EGFR-targeted therapies like erlotinib .
PDZK1 Restoration Strategies: Given PDZK1's tumor-suppressive properties in TNBC, therapeutic approaches aimed at restoring PDZK1 expression or function might represent a novel strategy for TNBC treatment .
Combination Therapies: Understanding PDZK1's role in drug resistance might inform the development of combination therapies that target both EGFR and mechanisms regulating PDZK1 expression or function .
Several promising research directions for PDZK1 antibodies include:
Single-Cell Analysis: Application of PDZK1 antibodies in single-cell protein analysis to understand cell-to-cell variation in PDZK1 expression and its correlation with cellular phenotypes.
In Vivo Imaging: Development of labeled PDZK1 antibodies for in vivo imaging applications to monitor PDZK1 expression dynamics in tumor models.
Therapeutic Antibodies: Exploration of antibody-based therapeutic approaches targeting the PDZK1-EGFR interaction to modulate EGFR signaling in TNBC.
These emerging areas highlight the continuing importance of PDZK1 antibodies as tools for both basic research and translational applications in cancer biology and beyond.
While PDZK1 antibodies are valuable research tools, several technical challenges and considerations warrant attention.
Ensuring antibody specificity is crucial for accurate interpretation of experimental results:
Isoform Specificity: PDZK1 can exist in different isoforms, and antibodies may vary in their ability to recognize specific isoforms.
Cross-Reactivity: While some PDZK1 antibodies show cross-reactivity across species (human, mouse, rat), researchers should verify the species reactivity for their specific applications .
Validation in Multiple Systems: Confirming antibody specificity through multiple validation approaches, such as RNAi knockdown and correlation with mRNA expression, is essential for reliable results .
Different experimental techniques may require specific optimization approaches:
Sample Preparation: The method of sample preparation (e.g., fixation methods for IHC/IF, lysis conditions for WB/IP) can significantly impact antibody performance.
Detection Systems: Selection of appropriate secondary antibodies or detection systems can influence sensitivity and specificity.
Background Reduction: Strategies to minimize non-specific binding, such as optimizing blocking conditions and antibody dilutions, are crucial for obtaining clean results.
Addressing these technical considerations enhances the reliability and reproducibility of experiments employing PDZK1 antibodies.
PDZK1 protein is a scaffold protein that plays a critical role in regulating the surface expression and activity of plasma membrane proteins, particularly in epithelial cells. It interacts with various membrane transporters and receptors, such as scavenger receptor class B type I (SCARB1), cystic fibrosis transmembrane conductance regulator (CFTR), and organic anion transporting polypeptides (OATPs). These interactions influence physiological processes like cholesterol homeostasis, ion transport, and second messenger cascades . For example, PDZK1's interaction with SCARB1 is essential for maintaining normal plasma cholesterol levels, while its association with CFTR facilitates chloride channel activity . Additionally, PDZK1 has been implicated in multidrug resistance mechanisms through its interaction with ABCC2 and PDZK1IP1 .
PDZK1 antibody is instrumental in investigating protein-protein interactions via immunoprecipitation and co-immunoprecipitation techniques. For instance, studies have demonstrated that PDZK1 interacts with PLC-β3 and somatostatin receptors (SSTRs) to form ternary complexes essential for specific signaling pathways such as ERK phosphorylation and calcium signaling . Immunoprecipitation experiments using anti-PDZK1 antibodies have also elucidated its interaction with OATP1A2 and revealed its role in modulating transporter function through clathrin-dependent internalization mechanisms . These methodologies enable researchers to dissect the molecular complexes formed by PDZK1 and its binding partners, providing insights into their physiological significance.
PDZK1 expression can be detected using several experimental techniques:
Western Blotting (WB): This method quantifies PDZK1 protein levels in various tissues or cell lines. For example, Western blot analysis has been used to detect PDZK1 expression in human kidney sections and breast cancer cell lines such as MCF-7 .
Immunohistochemistry (IHC): IHC staining allows visualization of PDZK1 localization within tissue sections. Studies have shown that PDZK1 is predominantly localized to the brush border of proximal tubules in the kidney .
Immunofluorescence (IF): This technique provides spatial information about PDZK1's subcellular localization. Immunofluorescence studies have revealed that PDZK1 interacts with unphosphorylated oatp1a1 to optimize plasma membrane distribution .
These methods collectively enable researchers to analyze the expression patterns and functional roles of PDZK1 across different biological contexts.
PDZK1 regulates transporter proteins such as OATP1A2 by modulating their subcellular trafficking and stability. Co-expression of PDZK1 enhances OATP1A2's functional activity by increasing its presence at the plasma membrane and reducing internalization through clathrin-dependent pathways . This regulation is mediated by direct interactions between PDZ domains of PDZK1 and the C-terminal motifs of OATP proteins. For example, substrate uptake studies have shown that estrone-3-sulfate transport by OATP1A2 increases significantly upon co-expression with PDZK1 . Thus, PDZK1 serves as a critical adaptor protein that influences the efficiency of membrane transporters.
PDZK1 has emerged as a significant factor in cancer biology due to its regulatory effects on cellular signaling pathways. In breast cancer, particularly triple-negative breast cancer (TNBC), low levels of PDZK1 are associated with poor prognosis and resistance to EGFR-targeted therapies like erlotinib . Mechanistically, PDZK1 promotes EGFR degradation by enhancing its binding to c-Cbl and inhibits EGFR phosphorylation by preventing dimerization . Furthermore, studies have shown that ectopic expression of PDZK1 can enhance cell proliferation through increased c-Myc expression in estrogen receptor-positive breast cancer cells . These findings suggest that PDZK1 may serve as both a prognostic biomarker and a therapeutic target in oncology.
Discrepancies in experimental data involving PDZK1 antibody may arise due to variations in antibody specificity, experimental conditions, or sample preparation techniques. To address these issues:
Validation: Use multiple antibodies targeting different epitopes of PDZK1 for cross-validation.
Optimization: Optimize assay conditions such as antibody concentration, incubation time, and buffer composition based on preliminary experiments.
Controls: Include appropriate positive and negative controls to ensure specificity.
For example, immunoreactive bands detected by anti-PDZK1 antibodies may vary due to post-translational modifications or alternative splicing events . Researchers should consider these factors when interpreting results.
Computational modeling plays a crucial role in analyzing PDZ domain interactions. Machine learning algorithms have been employed to construct models predicting ligand selectivity based on experimental data from peptide arrays, phage display assays, and high-throughput binding studies . These models use position weight matrices (PWMs) derived from pocket residues within the PDZ domains to calculate binding scores for candidate proteins. Such computational approaches enable researchers to prioritize potential interacting partners of PDZ domains like those found in PDZK1, facilitating the discovery of novel molecular complexes.
Serine phosphorylation significantly affects the interaction between oatp proteins (e.g., oatp1a) and PDZK1 by altering their subcellular localization. Studies have shown that unphosphorylated oatp proteins exhibit optimal plasma membrane distribution when interacting with PDZK1. Conversely, phosphorylated oatp proteins demonstrate reduced cell surface expression even when co-expressed with PDZK1 . This differential behavior underscores the importance of post-translational modifications in regulating protein-protein interactions mediated by scaffold proteins like PDZK1.
RNA interference (RNAi) enables targeted knockdown of PDZK1 gene expression to investigate its functional roles. Small interfering RNA (siRNA) duplexes specific to nucleotides within the coding sequence of PDZK1 can be synthesized for transfection into cell lines . Knockdown experiments have demonstrated that silencing PDZK1 impairs ER-dependent growth in breast cancer cells and reduces c-Myc expression . RNAi-based approaches provide valuable insights into gene function by selectively inhibiting target transcripts.