PEX7 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to PEX7 Protein and Biological Role

The PEX7 protein, encoded by the PEX7 gene, is a cytosolic receptor critical for peroxisomal matrix protein import via the peroxisomal targeting signal 2 (PTS2) pathway . It facilitates the transport of enzymes like alkylglycerone phosphate synthase (AGPS) and phytanoyl-CoA hydroxylase (PHYH) into peroxisomes, enabling plasmalogen synthesis and phytanic acid oxidation . Deficiencies in PEX7 disrupt peroxisomal function, leading to disorders such as rhizomelic chondrodysplasia punctata type 1 (RCDP1) and Refsum disease (RD) .

Development and Validation of PEX7 Antibodies

PEX7 antibodies are essential tools for studying peroxisomal biology and diagnosing related disorders. These antibodies are developed using immunogens derived from conserved regions of the PEX7 protein, such as the peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD .

Validation methods include:

  • Western blotting: Detects endogenous PEX7 at ~36–40 kDa in human tissues (e.g., fetal muscle, MCF7 cells) .

  • Immunohistochemistry (IHC): Localizes PEX7 expression in cerebellar Purkinje cells and peroxisomes .

  • Functional assays: Restores PTS2-protein import in PEX7-deficient fibroblasts .

4.1. Mechanistic Studies in Peroxisomal Disorders

  • Mouse models: Graded Pex7 deficiency (null, hypo/null, hypo/hypo) correlates with plasmalogen (Pls) reduction, phytanic acid (PA) accumulation, and cerebellar Purkinje cell loss .

  • Cellular assays: Overexpression of mutant PEX7 alleles (e.g., Y40X, T14P) in fibroblasts reveals impaired PTS2-protein import .

4.2. Biomarker Analysis

  • Lipidomics: Elevated C26:0-lysophosphatidylcholine (C26:0-LPC) in Pex7 null/null mice indicates very-long-chain fatty acid (VLCFA) metabolism defects .

  • Neurotransmitter profiling: Reduced dopamine, norepinephrine, and GABA levels in Pex7-deficient brains .

5.1. Genetic Disorders Linked to PEX7 Mutations

DisorderMutationBiochemical DefectPhenotype
RCDP1L292X, A218V, G217R Plasmalogen deficiencySkeletal dysplasia, cataracts
Refsum DiseaseMild PEX7 alleles Phytanic acid accumulationRetinitis pigmentosa, ataxia

5.2. Diagnostic Utility

  • Immunoblotting: Absent/reduced PEX7 protein in patient fibroblasts confirms RCDP1 .

  • IHC: Loss of peroxisomal thiolase localization in Purkinje cells correlates with disease severity .

Challenges and Considerations

  • Antibody specificity: Cross-reactivity with non-target proteins necessitates rigorous validation (e.g., protein arrays, knockout controls) .

  • Species variability: Limited reactivity in non-human models unless homologs are conserved .

  • Therapeutic research: Small increases in PEX7 expression (5–10%) improve phenotypes in hypomorphic mice, highlighting potential for gene therapy .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
PEX7 antibody; At1g29260 antibody; F28N24.6Peroxisome biogenesis protein 7 antibody; Peroxin-7 antibody; AtPEX7 antibody; Peroxisomal targeting signal type 2 receptor antibody; Pex7p antibody
Target Names
PEX7
Uniprot No.

Target Background

Function
PEX7 is an import receptor for peroxisomal targeting signal two (PTS2). A receptor-cargo complex composed of PEX5, PEX7, a PTS1-containing protein and a PTS2-containing protein is targeted to peroxisomes during import.
Gene References Into Functions
  1. Peroxisomal plant nitric oxide synthase (NOS) protein is imported by peroxisomal targeting signal type 2 (PTS2) in a process that depends on the cytosolic receptor PEX7 and calmodulin. PMID: 24801177
  2. RabE1c binds PEX7 and facilitates PEX7 degradation in the presence of immobile GFP-PEX7 accumulated at the membrane. PMID: 23297417
  3. Studies suggest that the targeting of PEX7 to peroxisomes requires four proteins: a PTS2-containing protein, PEX14, PEX13 and PEX12. PMID: 19594707
Database Links

KEGG: ath:AT1G29260

STRING: 3702.AT1G29260.1

UniGene: At.11271

Protein Families
WD repeat peroxin-7 family
Subcellular Location
Cytoplasm. Peroxisome membrane; Peripheral membrane protein. Note=The loss of PEX12, PEX13 or PEX14 prevents the targeting of PEX7 to peroxisomes.
Tissue Specificity
Expressed in siliques and leaves, but barely detectable in flowers, stems and roots.

Q&A

What is PEX7 and what is its function in cellular biology?

PEX7 functions as a receptor required for the peroxisomal import of proteins containing a C-terminal PTS2-type peroxisomal targeting signal. It specifically binds to cargo proteins containing a PTS2 peroxisomal targeting signal in the cytosol. This cargo protein-binding triggers interaction with PEX5 and formation of a ternary complex composed of PEX5 and PEX7 along with PTS2-containing cargo proteins, which is then translocated into peroxisomes by passing through the PEX13-PEX14 docking complex .

PEX7 is particularly important for the import of three known PTS2-enzymes:

  • Alkylglycerone-phosphate synthase (AGPS)

  • Phytanoyl-CoA hydroxylase (PHYH)

  • 3-oxoacyl-CoA thiolase or acetyl-CoA acyltransferase (ACAA1)

Mutations in the PEX7 gene are associated with peroxisomal disorders, including rhizomelic chondrodysplasia punctata type 1 (RCDP1) and certain forms of Refsum disease .

What applications are PEX7 antibodies suitable for?

Based on commercially available antibodies and research literature, PEX7 antibodies have been validated for multiple applications:

ApplicationAntibody TypeDilutionReference
Western Blotting (WB)Polyclonal1/500-1/2000
Western Blotting (WB)Recombinant Monoclonal1/1000
Immunohistochemistry (IHC-P)Polyclonal5 μg/ml
ELISAPolyclonal1 μg/ml
ImmunofluorescenceMonoclonalVariable

For optimal results in Western blotting, higher protein quantities (up to 100 μg) and longer exposure times (up to 20 minutes) may be necessary when working with samples containing low PEX7 expression, such as hypomorphic mouse models .

How should sample preparation be optimized for PEX7 detection?

For brain tissue samples:

  • Homogenize cerebral cortex and cerebellar tissues using TissueLyser II (QIAGEN, cat#:85300) in RIPA buffer

  • For Western blotting of samples with potentially low PEX7 expression, increase protein loading to 100 μg (compared to standard 40 μg)

  • For immunohistochemistry, use formalin fixation and paraffin embedding, with appropriate antigen retrieval methods

For immunoblotting of tissues from PEX7-deficient models, optimization parameters include:

  • Protein quantity: 40 μg for normal expression; up to 100 μg for hypomorphic models

  • Exposure time: 10 minutes for normal expression; up to 20 minutes for hypomorphic models

How can PEX7 antibodies be utilized to study genotype-phenotype correlations in peroxisomal disorders?

PEX7 antibodies can be instrumental in analyzing the relationship between gene mutations and disease severity in peroxisomal disorders. Based on research with PEX7-deficient mouse models, the following methodological approach is recommended:

  • Establish multiple models with graded deficiency (e.g., null/null, hypo/null, hypo/hypo)

  • Use PEX7 antibodies for immunoblotting to quantify PEX7 protein levels across genotypes

  • Perform immunohistochemistry to determine tissue-specific expression patterns, with particular focus on cerebellar Purkinje cells where PEX7 is highly expressed

  • Correlate PEX7 expression levels with:

    • Biochemical parameters (plasmalogen levels, very long chain fatty acids, phytanic acid)

    • Histological findings (myelin content, Purkinje cell counts)

    • Behavioral phenotypes

    • Neurotransmitter levels

Research has shown that even extremely low PEX7 expression levels (<1% of normal transcript) can significantly improve phenotypic outcomes compared to complete knockout models, providing valuable insights for therapeutic development .

What controls are essential when using PEX7 antibodies in genetically modified models?

When working with PEX7 antibodies in knockout or hypomorphic models, include the following controls:

  • Loading controls: Use housekeeping proteins such as β-tubulin (1:17,000, Abcam, ab6046) for normalization

  • Genetic controls: Include a range of genotypes:

    • Wild-type controls (Pex7+/+)

    • Heterozygous models (Pex7hypo/+)

    • Graded hypomorphic models (Pex7hypo/hypo, Pex7hypo/null)

    • Complete knockout models (Pex7null/null)

  • Specificity controls:

    • Include tissues from PEX7 knockout mice to confirm antibody specificity

    • For immunoblotting in hypomorphic models with very low expression, use extended exposure times (20+ minutes) to detect trace amounts of PEX7 protein

  • Age-matched controls: Important for developmental studies, as PEX7-deficient phenotypes can progress over time (particularly for Purkinje cell loss and myelin defects)

How can researchers optimize PEX7 immunodetection in cerebellar Purkinje cells?

PEX7 is markedly localized to cerebellar Purkinje cells, making these neurons an important target for PEX7 antibody-based studies . Optimized protocols for Purkinje cell PEX7 detection include:

  • For immunohistochemistry:

    • Use mid-sagittal cerebellar sections (0.875-1.10 mm lateral to midline)

    • Analyze 3-4 cerebellar slices in entirety per genotype

    • Consider age-dependent changes (1, 4, and 12 months of age show progressive changes)

    • Use Calbindin-D28K as a Purkinje cell marker for co-localization studies

    • Counterstain with hematoxylin for better visualization

  • For quantification:

    • Count Purkinje cells using the cell counter plugin from ImageJ software

    • Have multiple independent researchers perform counts to ensure reliability

    • Express results as Purkinje cell density per unit length of Purkinje cell layer

  • For comparison with other markers:

    • Consider parallel staining for myelin basic protein (MBP) to correlate PEX7 expression with myelination status

    • In PEX7-deficient models, reduced MBP staining in cerebellar white matter correlates with PEX7 deficiency severity

How can researchers troubleshoot weak or absent PEX7 signal in Western blotting?

When faced with weak or absent PEX7 signal, consider the following optimization strategies:

  • Increase protein loading:

    • Standard: 40 μg protein

    • For weak signal/hypomorphic models: increase to 100 μg protein

  • Extend exposure time:

    • Standard: 10 minutes

    • For weak signal/hypomorphic models: increase to 20 minutes or longer

  • Antibody concentration optimization:

    • For polyclonal antibodies: test range from 1/500 to 1/2000

    • For monoclonal antibodies: standard 1/1000 dilution, adjust as needed

  • Sample preparation improvements:

    • Ensure complete homogenization using appropriate equipment (e.g., TissueLyser II)

    • Use protease inhibitors in lysis buffer

    • Consider different extraction buffers if RIPA buffer yields poor results

  • Detection system enhancement:

    • Use high-sensitivity chemiluminescent substrates

    • Consider alternative visualization methods (e.g., Amersham 600 gel imager)

What factors might cause variability in PEX7 antibody performance across different experimental models?

Several factors can affect PEX7 antibody performance when comparing different experimental systems:

  • Tissue-specific expression patterns:

    • PEX7 is highly expressed in cerebellar Purkinje cells

    • Expression levels vary across tissues (cerebral cortex, cerebellum, liver, lung, kidney)

  • Age-dependent expression:

    • In mouse models, PEX7-related phenotypes (e.g., Purkinje cell loss, myelin defects) progress with age

    • Consider age-matching experimental groups, especially at 1, 4, and 12 months

  • Antibody targeting region:

    • Different antibodies target different epitopes

    • Some mutations or splice variants may affect specific epitope recognition

    • Consider using antibodies targeting different regions for confirmation

  • Species reactivity differences:

    • Confirm species reactivity (human, mouse, rat)

    • Note that even antibodies listed as reactive may show variable performance across species

    • Adjust concentrations for cross-species applications

  • PEX7 transcript considerations:

    • In hypomorphic models, extremely low PEX7 transcript levels (<1% of normal) may be difficult to detect by qPCR but can still produce functional protein

    • Correlation between transcript and protein levels may be non-linear

How can PEX7 antibodies be used to investigate the relationship between peroxisomal function and neurotransmitter metabolism?

Recent research has revealed important connections between PEX7 function, plasmalogen levels, and neurotransmitter metabolism . To investigate these relationships:

  • Experimental design approach:

    • Generate graded PEX7-deficient models (null/null, hypo/null, hypo/hypo)

    • Use PEX7 antibodies to confirm and quantify expression levels

    • Analyze tissue-specific effects, particularly in cerebellar Purkinje cells

  • Neurotransmitter analysis correlation:

    • PEX7-deficient mice show significant reductions in:

      • Dopamine

      • Norepinephrine

      • Serotonin

      • GABA

    • These reductions correlate with:

      • PEX7 genotype severity

      • Plasmalogen levels

      • Hyperactivity phenotype

  • Methodological considerations:

    • Combine PEX7 immunodetection with neurotransmitter quantification

    • Correlate cellular PEX7 expression with regional neurotransmitter levels

    • Consider behavioral phenotyping to establish functional correlations

This approach has revealed that even small increases in PEX7 levels can dramatically improve neurotransmitter profiles and behavioral outcomes, providing valuable insights for therapeutic development .

What methodological approaches are recommended for studying PEX7 mutations in patient-derived samples?

When investigating PEX7 mutations in patient samples, consider these methodological approaches:

  • Mutation validation and characterization:

    • Express patient PEX7 alleles in PEX7-deficient cell lines

    • Use PTS2-tagged GFP constructs to assess functional rescue

    • Compare punctate (peroxisomal) versus diffuse (cytosolic) fluorescence patterns

  • Protein expression analysis:

    • Use Western blotting to assess PEX7 protein levels

    • For potentially low-expressing mutants, increase protein loading (≥100 μg)

    • Extend exposure times to detect trace amounts of protein

  • Functional import assays:

    • Assess import of PTS2-containing proteins (AGPS, PHYH, ACAA1)

    • Combine with PEX7 immunodetection to correlate expression with function

    • Look for discrepancies between overexpression results and endogenous settings

  • Specific mutation considerations:

    • Nonsense mutations (e.g., Y40X): typically cause complete loss of function

    • Missense mutations (e.g., T14P): may affect protein folding or binding partner affinity

    • Duplications near start codons: may allow use of alternative start sites, producing N-terminally truncated but partially functional proteins

How might PEX7 antibodies contribute to developing therapeutic approaches for peroxisomal disorders?

PEX7 antibodies can play crucial roles in therapeutic development for peroxisomal disorders through several approaches:

  • Assessing therapeutic efficacy:

    • Use PEX7 antibodies to monitor protein expression following gene therapy or small molecule interventions

    • Correlate increases in PEX7 expression with biochemical and clinical improvements

    • Research indicates that even small increases in PEX7 expression can dramatically improve phenotypes

  • Tissue-specific targeting strategies:

    • PEX7 immunohistochemistry reveals high expression in cerebellar Purkinje cells

    • This knowledge can guide development of CNS-targeted therapies

    • Monitor tissue-specific restoration of PEX7 expression following therapeutic interventions

  • Phenotypic rescue correlation:

    • Use PEX7 antibodies to correlate protein expression with:

      • Improvement in biochemical parameters (plasmalogen levels, VLCFA, phytanic acid)

      • Histological improvements (Purkinje cell survival, myelin content)

      • Behavioral outcomes

      • Neurotransmitter normalization

  • Mechanism-based therapeutic development:

    • Better understanding of structure-function relationships in PEX7 can guide development of:

      • Protein stabilization approaches

      • Improved intracellular trafficking

      • Enhanced interaction with cargo proteins and other peroxins

What considerations are important when validating novel PEX7 antibodies for research applications?

When validating new PEX7 antibodies, researchers should consider:

  • Epitope characterization:

    • Identify the specific region of PEX7 targeted by the antibody

    • Consider how known mutations or splice variants might affect recognition

    • Target conserved regions for cross-species applications

  • Specificity validation:

    • Test in PEX7 knockout tissues/cells as negative controls

    • Compare multiple antibodies targeting different epitopes

    • Evaluate cross-reactivity with related proteins

  • Sensitivity assessment:

    • Determine detection limits using dilution series

    • Test in hypomorphic models with extremely low expression (<1% of normal)

    • Optimize detection parameters (protein loading, exposure time) for low-expressing samples

  • Application-specific validation:

    • For Western blotting: determine optimal concentrations, blocking conditions, and detection methods

    • For immunohistochemistry: optimize fixation, antigen retrieval, and visualization systems

    • For immunofluorescence: validate sub-cellular localization patterns in known PEX7-expressing tissues

  • Cross-species reactivity:

    • Validate across relevant species (human, mouse, rat) if cross-reactivity is claimed

    • Adjust protocols for species-specific applications

    • Consider using conserved peptide sequences as immunogens for broad species reactivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.