PFKM Antibody

What are the optimal conditions for PFKM antibody applications across different detection methods?

Western Blot applications require careful optimization of antibody dilution based on the specific antibody source and sample type. For polyclonal PFKM antibodies, recommended dilutions range from 1:500-1:5000 for initial tests, with optimal concentrations of 0.2-0.4 μg/mL demonstrating consistent detection of the 85 kDa PFKM protein band . For monoclonal PFKM antibodies, a higher concentration (approximately 2 μg/mL) may be required for Simple Western applications .

For immunohistochemistry applications, dilutions typically range from 1:50-1:1600 depending on the antibody source, with most protocols recommending 1:200-1:400 for paraffin-embedded samples . Antigen retrieval using TE buffer (pH 9.0) has been shown to enhance signal-to-noise ratio in skeletal muscle tissues .

Immunofluorescence applications generally require dilutions between 1:10-1:800, with most protocols standardizing at 1:200 for cell lines such as HeLa .

What are the key considerations for storage and handling of PFKM antibodies to maintain optimal reactivity?

PFKM antibody stability is significantly affected by storage conditions and handling practices. According to multiple manufacturers' guidelines, lyophilized antibodies should be stored at -20°C to -70°C for long-term preservation (up to 12 months from receipt) . After reconstitution, antibodies maintain optimal reactivity for approximately 1 month at 2-8°C under sterile conditions, or 6 months at -20°C to -70°C .

Manual defrost freezers are strongly recommended to avoid repeated freeze-thaw cycles, which can significantly impair antibody function through denaturation and aggregation . For reconstituted antibodies, aliquoting is essential to minimize freeze-thaw exposure .

Buffer composition also affects stability, with most PFKM antibodies optimally preserved in PBS with either glycerol (40-50%) or trehalose, and 0.02% sodium azide as a preservative . Small pack size antibodies that contain 0.1% BSA demonstrate enhanced stability during storage .

How does PFKM antibody specificity vary across different tissue types and experimental models?

Skeletal muscle tissue consistently shows the highest PFKM expression levels across species, making it an ideal positive control for antibody validation . Heart tissue also demonstrates strong PFKM expression, though at slightly lower levels than skeletal muscle . In cancer tissues, PFKM expression patterns can be highly variable and require rigorous validation controls .

Cross-reactivity analysis indicates that some PFKM antibodies may partially detect the liver isoform (PFKL) due to structural homology between isoenzymes . This is particularly important when studying tissues with mixed expression of PFK isoforms.

Species reactivity testing confirms that most commercially available PFKM antibodies reliably detect human, mouse, and rat PFKM, with predicted reactivity in pig, bovine, horse, sheep, rabbit, dog, chicken, and xenopus based on sequence homology .

What methodological approaches are recommended for investigating the relationship between PFKM expression and cancer progression?

Investigating PFKM in cancer research requires a multi-methodological approach that addresses both expression levels and functional significance. Based on recent studies, the following workflow has proven effective:

How can researchers effectively distinguish between different phosphofructokinase isoforms (PFKM, PFKL, PFKP) in complex biological samples?

Distinguishing between phosphofructokinase isoforms presents significant technical challenges due to their structural homology. A systematic approach combining multiple techniques yields the most reliable results:

• Antibody selection and validation: Select antibodies raised against isoform-specific regions. For PFKM, antibodies targeting the peptide sequence "CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA" have demonstrated high specificity . Validate specificity through Western blot analysis of tissues with known isoform expression patterns (skeletal muscle for PFKM, liver for PFKL, platelets for PFKP).

• Western blot optimization: Utilize gradient gels (4-15%) to maximize separation of isoforms, which typically range from 80-87 kDa. Implement reducing conditions with Immunoblot Buffer Group 1 for optimal resolution .

• Immunoprecipitation followed by mass spectrometry: This approach enables definitive identification of specific isoforms. IP protocols using 0.5-4.0 μg antibody per 1.0-3.0 mg total protein lysate have successfully isolated PFKM for further characterization .

• qRT-PCR for isoform-specific mRNA: Complement protein detection with transcript analysis using validated primers for each isoform. In cancer studies, this approach has successfully differentiated the prognostic significance of different PFK isoforms .

• Tissue-specific analysis: Leverage the differential tissue expression patterns of PFK isoforms (PFKM predominantly in muscle and heart, PFKL in liver, PFKP in platelets and cancer cells) as internal validation controls .

What are the critical factors affecting reproducibility in PFKM antibody-based detection methods?

Reproducibility challenges in PFKM antibody applications can be addressed through comprehensive protocol standardization:

• Antibody validation requirements: All PFKM antibodies should undergo multi-platform validation. Current gold standards include Western blot demonstration of specific bands at 85 kDa in multiple tissues (human/mouse/rat heart tissue) and confirmation in Simple Western systems showing bands at 84 kDa . Cross-validation with multiple antibodies (monoclonal and polyclonal) from different sources enhances reliability.

• Sample preparation standardization: For Western blot applications, consistent lysis conditions are critical. Protocols using PVDF membranes with reducing conditions and Immunoblot Buffer Group 1 have demonstrated the most consistent results . For tissue samples, immediate cryopreservation or fixation in 4% paraformaldehyde is essential to prevent enzymatic degradation .

• Signal detection and quantification: For immunohistochemistry applications, standardized scoring systems are necessary. Studies have successfully implemented semi-quantitative scoring (0-3+) with independent pathologist verification to reduce subjective interpretation . For Western blot quantification, normalization to total protein rather than single housekeeping genes provides more reliable results in metabolically active tissues.

• Batch effects mitigation: Include consistent positive controls (skeletal muscle tissue) across experimental batches. Inter-laboratory standardization can be achieved through antibody validation using protein arrays containing target protein plus non-specific proteins .

• Data reporting standards: Comprehensive reporting of antibody catalog numbers, dilutions, incubation conditions, blocking reagents, and detection systems is essential for reproducibility. The observed molecular weight should always be reported alongside the calculated molecular weight to account for post-translational modifications .

How can researchers integrate PFKM antibody data with metabolomic and transcriptomic analyses for comprehensive glycolytic pathway investigation?

Multi-omics integration strategies for PFKM research require carefully aligned methodological approaches:

• Coordinated sample processing: For parallel antibody-based protein detection and transcriptomic/metabolomic analyses, implement split-sample protocols where tissues are simultaneously processed for protein extraction (for Western blot/IHC), RNA extraction (for transcriptomics), and metabolite extraction (for metabolomics). This minimizes variation due to sample heterogeneity.

• Temporal alignment of glycolytic measurements: PFKM protein levels (detected by antibodies) represent a different temporal snapshot than transcript levels or metabolite concentrations. Consider time-course experiments that capture the dynamic relationship between PFKM expression and downstream metabolic effects.

• Functional validation through enzyme activity assays: Complement antibody-based detection of PFKM protein with functional enzyme activity assays to link expression levels with metabolic flux. This approach has been particularly valuable in cancer studies where PFKM overexpression correlates with altered glycolytic rates .

• Pathway-level data integration: Utilize computational approaches that integrate antibody-based protein quantification with transcript abundance and metabolite concentrations. Recent studies examining the relationship between glycolytic enzymes (LDHA and PFKP) and clinical outcomes have successfully implemented this approach .

• Single-cell analysis considerations: When integrating antibody-based detection with single-cell transcriptomics, carefully optimize immunofluorescence protocols (1:10-1:100 dilutions) to maintain cellular integrity while achieving sufficient signal for co-localization studies .

What are the emerging applications of PFKM antibodies in cancer immunotherapy research?

The intersection of PFKM research and cancer immunotherapy represents an emerging frontier with significant methodological considerations:

• PFKM as an immunotherapy response biomarker: Recent pancancer analyses reveal that PFKM expression correlates with PD-L1 levels, suggesting potential applications as a predictive biomarker for immunotherapy response . When implementing PFKM antibodies for this purpose, multiparameter immunofluorescence protocols that simultaneously detect PFKM and immune markers provide the most comprehensive data.

• Metabolic reprogramming assessment: PFKM antibody-based detection can quantify cancer-associated glycolytic shifts that influence the tumor immune microenvironment. Studies examining the relationship between PFKM expression and immune cell infiltration have implemented dual immunohistochemistry protocols with standardized cutoff values for high versus low expression .

• Therapeutic target validation: In HNSCC models, the positive feedback loop between PFKM and c-Myc has been effectively targeted using combination approaches with siRNA and metabolic inhibitors . For researchers developing similar therapeutic strategies, antibody-based confirmation of target engagement is essential for advancing to clinical applications.

• Patient stratification applications: PFKM antibody-based tissue analysis has demonstrated prognostic value independent of clinical staging, suggesting potential for improved patient stratification . Implementation requires careful standardization of immunohistochemistry protocols with digital pathology quantification to minimize interpreter bias.

• Monitoring treatment response: Serial sampling protocols that track PFKM expression during immunotherapy treatment can provide insights into metabolic adaptation mechanisms. This approach requires consistent antibody lots and standardized sample processing to allow for reliable longitudinal comparisons.