PGA3 Antibody

Shipped with Ice Packs
In Stock

Description

Structure and Function of PGA3 Antibody

PGA3 antibodies are polyclonal, targeting specific regions of the PGA3 protein. Key structural and functional details include:

Immunogen Sequences and Target Regions

The antibody’s specificity is determined by its immunogen, which varies by product:

Antibody IDImmunogen SequenceReactivityHost
PA5-120544VDEQPLENYL DMEYFGTIGIGTPAQDFTVV FDTGSSNLWV PSVYCSSLAC TNHNRFNPED SSTYQSTSET VSITYGTGSM TGILGYDTVQ VGGISDTNQI FGLSETEPGS FLYYAPFD Human, Mouse, RatRabbit
PA5-61360GTSLLTGPTS PIANIQSDIG ASENSDGDMV VSCSAISSLP DIVFTINGVQ YPVPPSAYI Human, Mouse, RatRabbit
ABIN6749590Synthetic peptide (aa156-205) Human, Cow, Dog, Horse, Pig, Rabbit, Bat, Chicken, MonkeyRabbit
HPA046875GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI HumanRabbit

Note: Sequence identity for PA5-61360 shows 63% homology with mouse and 61% with rat, enabling cross-reactivity .

Applications in Research

PGA3 antibodies are primarily used in:

Techniques and Validations

ApplicationAntibody IDValidation StatusKey Findings
Western BlotPA5-120544 Tested in C6, U-251MG, SGC-7901Detects endogenous PGA3 in secreted proteins and brain tissue
ImmunohistochemistryHPA046875 Enhanced validation (44 human tissues)Localized to gastric mucosa and pancreatic tissues
ELISAABIN6749590 Predicted reactivityUsed for quantifying PGA3 levels in serum or tissue lysates

Associated Diseases

PGA3 is implicated in:

DiseaseMechanismSource
Atrophic GastritisReduced pepsinogen secretion linked to chronic inflammation and mucosal atrophy
GastritisAltered PGA3 expression in gastric epithelial cells

Related Pathways

PathwayRole of PGA3Source
Collagen Chain TrimerizationModulates extracellular matrix remodeling via proteolytic activity
Protein MetabolismDegrades dietary proteins in the stomach

Key Identifiers

ParameterValueSource
Gene NamePGA3
UniProt IDP0DJD8 (Human)
Entrez Gene ID643834
Protein AliasesPepsinogen A3, PGA4, PGA5

Paralogs

PGA3 shares homology with PGA4, a critical paralog in gastric acid secretion .

Research Challenges and Considerations

  • Cross-Reactivity: Some antibodies (e.g., PA5-61360) show partial homology with rodent PGA3, necessitating species-specific validation .

  • Detection Limitations: Secreted PGA3 may require optimized protocols for Western Blot detection in non-gastric tissues .

  • Safety: Thermo Fisher products contain mercury (PA5-120544), requiring handling precautions .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
PGA3 antibody; At1g02790 antibody; F22D16.22 antibody; T14P4_2Exopolygalacturonase clone GBGE184 antibody; ExoPG antibody; EC 3.2.1.67 antibody; Galacturan 1,4-alpha-galacturonidase antibody; Pectinase antibody
Target Names
PGA3
Uniprot No.

Target Background

Function
PGA3 Antibody may function in the depolymerization of pectin during pollen development, germination, and tube growth. It acts as an exo-polygalacturonase.
Database Links

KEGG: ath:AT1G02790

STRING: 3702.AT1G02790.1

UniGene: At.22350

Protein Families
Glycosyl hydrolase 28 family
Subcellular Location
Secreted. Secreted, cell wall.

Q&A

What is PGA3 and why is it significant in research?

PGA3 (Pepsinogen A3) is a protein-coding gene primarily associated with digestive functions. It has gained research significance due to its associations with gastric conditions including Atrophic Gastritis and Gastritis . The protein belongs to the aspartic protease family and possesses endopeptidase activity, playing a role in protein metabolism pathways. Research into PGA3 has become increasingly important for understanding gastric pathophysiology and potentially identifying biomarkers for gastric conditions. PGA3 functions within collagen chain trimerization and protein metabolism pathways, making its study relevant for both basic biological understanding and medical applications .

How do I select the appropriate PGA3 antibody for my experiment?

Selection of an appropriate PGA3 antibody requires careful consideration of multiple factors. First, determine your experimental application (Western blotting, ELISA, IHC) as different antibodies show varying efficacy across applications. For Western blotting applications, antibodies such as catalog ABIN7269204 have been specifically validated . For multiple applications including ELISA, WB, and IHC, consider antibodies with broader validation like those described in search result .

Second, consider the epitope recognition - different antibodies target distinct regions of PGA3. For example, some target amino acids 63-180 , while others target different sequences. The choice should align with the specific region of interest in your study. Finally, evaluate species cross-reactivity based on your experimental model. Some PGA3 antibodies react with human, mouse, and rat samples , while others may have limited species reactivity. Always review validation data and literature citations before making your selection.

What are the key differences between polyclonal and monoclonal PGA3 antibodies?

While both antibody types have applications in PGA3 research, they differ fundamentally in their characteristics. Polyclonal PGA3 antibodies, like those described in search results , , and , recognize multiple epitopes on the PGA3 protein, providing higher sensitivity but potentially lower specificity. These are typically produced in rabbits immunized with recombinant proteins or synthetic peptides corresponding to PGA3 sequences .

Monoclonal antibodies recognize a single epitope, offering higher specificity but potentially lower sensitivity than polyclonals. For PGA3 detection, the choice between polyclonal and monoclonal depends on the research question. Polyclonal antibodies may be preferable for applications requiring high sensitivity (detecting low-abundance PGA3) or when the native protein conformation might be altered. Monoclonal antibodies are typically preferred when absolute specificity is critical, such as distinguishing between closely related pepsinogen family members (PGA3, PGA4, PGA5).

What are the optimal conditions for using PGA3 antibodies in Western blotting?

Successful Western blotting with PGA3 antibodies requires careful optimization of several parameters. Based on available product information, the following protocol is recommended: Begin with sample preparation using standard cell/tissue lysis buffers containing protease inhibitors to prevent PGA3 degradation. For electrophoresis, use 10-12% SDS-PAGE gels which provide optimal resolution for PGA3 (approximately 42 kDa).

After transfer to a nitrocellulose or PVDF membrane, block with 5% non-fat milk or BSA in TBST for 1 hour at room temperature. For primary antibody incubation, dilute PGA3 antibodies according to manufacturer recommendations, typically in the range of 1:1000-1:5000 . Incubate overnight at 4°C for optimal binding. After washing with TBST, apply an appropriate HRP-conjugated secondary antibody (anti-rabbit IgG for most available PGA3 antibodies) .

Visualization can be performed using standard chemiluminescence detection. For troubleshooting, if background is high, increase blocking time or antibody dilution; if signal is weak, decrease antibody dilution or increase exposure time. Validation should include appropriate positive controls (gastric tissue or cells known to express PGA3) and negative controls.

How can I optimize immunohistochemistry protocols for PGA3 detection?

For effective PGA3 detection in tissue samples via immunohistochemistry, the following methodological approach is recommended: Begin with proper tissue fixation, preferably using 10% neutral buffered formalin for 24-48 hours, followed by paraffin embedding and sectioning at 4-6 μm thickness. Antigen retrieval is crucial for PGA3 detection—use citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) with heat-induced epitope retrieval (pressure cooker or microwave).

Block endogenous peroxidase activity with 3% hydrogen peroxide for 10 minutes, followed by protein blocking with 5-10% normal serum. Apply PGA3 primary antibody at dilutions between 1:50-1:200 as recommended , and incubate overnight at 4°C in a humidified chamber. For detection, use polymer-based detection systems with HRP, followed by DAB (3,3'-diaminobenzidine) chromogen and hematoxylin counterstaining.

Critical controls should include a positive control (gastric tissue), negative control (omission of primary antibody), and potentially an absorption control (pre-incubation of antibody with PGA3 peptide). Optimization may require titration of antibody concentration and modification of antigen retrieval conditions based on initial results.

What considerations are important when using PGA3 antibodies in ELISA?

ELISA applications with PGA3 antibodies require specific methodological considerations. For direct ELISA, coat plates with recombinant PGA3 protein or tissue/cell lysates containing PGA3 in carbonate-bicarbonate buffer (pH 9.6) overnight at 4°C. For sandwich ELISA, use a capture antibody recognizing a different epitope than the detection PGA3 antibody.

The working dilution for PGA3 antibodies in ELISA applications typically ranges from 1:1000 to 1:5000 , but should be optimized for each specific antibody and experimental system. Blocking should be performed with 1-5% BSA or non-fat milk in PBS for 1-2 hours at room temperature. For detection, HRP-conjugated secondary antibodies or directly conjugated PGA3 antibodies (such as HRP or biotin-conjugated variants) can be used .

Standard curves should be generated using purified recombinant PGA3 protein at concentrations ranging from 0.1-1000 ng/mL. Cross-reactivity with other pepsinogen family members (particularly PGA4, a close paralog) should be assessed when quantifying PGA3 levels. For multiplex detection of PGA3, PGA4, and PGA5, specialized antibodies recognizing common epitopes across these proteins may be available .

How can I address non-specific binding issues with PGA3 antibodies?

Non-specific binding is a common challenge with PGA3 antibodies that can be systematically addressed. First, increase the concentration of blocking agent (5-10% BSA or non-fat milk) and extend blocking time to 2 hours at room temperature. Consider adding 0.1-0.5% Tween-20 to wash buffers and antibody diluents to reduce hydrophobic interactions. If background persists, titrate the primary antibody to higher dilutions (1:2000-1:5000) and reduce incubation time or temperature.

For Western blots, additional washing steps (5-6 washes, 10 minutes each) and the addition of 0.1% SDS to wash buffers can help reduce non-specific binding. In immunohistochemistry applications, pre-absorption of the antibody with a non-related protein mixture can reduce cross-reactivity. When using polyclonal PGA3 antibodies, be particularly vigilant about cross-reactivity with other pepsinogen family members like PGA4, as these share significant sequence homology with PGA3 .

If non-specific binding persists despite these measures, consider switching to a different PGA3 antibody that targets a more unique epitope, or validate your results using an alternative detection method such as mass spectrometry.

What are the common causes of false negative results when detecting PGA3?

False negative results in PGA3 detection can stem from multiple methodological issues that require systematic troubleshooting. One primary cause is protein degradation—PGA3, as a pepsinogen, can undergo self-activation in acidic conditions. Always maintain neutral pH during sample preparation and add protease inhibitors to prevent degradation. Inadequate antigen retrieval in immunohistochemistry can mask epitopes; optimize by testing multiple retrieval buffers and heating conditions.

Another common cause is improper antibody selection—ensure your antibody recognizes the specific PGA3 isoform present in your experimental system. Some antibodies target specific amino acid sequences (63-180 or 45-73) that might be inaccessible in certain experimental conditions. For Western blotting, check transfer efficiency, especially for PGA3 detection which may require optimized transfer conditions due to its molecular weight.

Finally, expression levels of PGA3 vary significantly between tissues and disease states. In non-gastric tissues or certain pathological conditions, PGA3 levels may be below detection thresholds. Consider using more sensitive detection methods (chemiluminescence substrates with higher sensitivity or amplification steps) or concentrate proteins before analysis.

How can PGA3 antibodies be used to differentiate between PGA family members?

Differentiating between closely related PGA family members (PGA3, PGA4, PGA5) requires careful antibody selection and validation strategies. First, select antibodies raised against unique regions of PGA3 that have minimal sequence homology with other family members. The sequence differences between amino acids 63-180 of PGA3 compared to equivalent regions in PGA4 and PGA5 can be exploited for specific detection .

For absolute specificity, validation is essential. Perform parallel experiments with recombinant PGA3, PGA4, and PGA5 proteins to assess cross-reactivity. Western blotting can reveal cross-reactivity based on band patterns at slightly different molecular weights. Alternatively, use competitive binding assays where pre-incubation with recombinant PGA3 should abolish specific binding while pre-incubation with PGA4 or PGA5 should not affect antibody binding if the antibody is truly specific.

For research requiring detection of multiple family members, consider using antibodies specifically designed to recognize PGA3/PGA4/PGA5 collectively , followed by secondary validation methods like mass spectrometry to distinguish between family members. Some applications may benefit from using a combination of antibodies, each specific to a different family member, applied in parallel experiments or in multiplex detection systems.

What is the significance of PGA3 in gastritis and atrophic gastritis research?

PGA3 has emerged as a significant biomarker in gastritis and atrophic gastritis research due to its specific expression pattern and relationship to disease progression. As a pepsinogen primarily produced by chief cells in the gastric mucosa, PGA3 levels in serum and tissue reflect the functional status of the gastric mucosa . In atrophic gastritis, the progressive loss of gastric glands leads to decreased production of pepsinogens, including PGA3.

Methodologically, researchers can use PGA3 antibodies for immunohistochemical assessment of gastric biopsies to evaluate the distribution and density of PGA3-expressing cells, which correlates with the severity of mucosal damage. The ratio of PGA3 to Pepsinogen C (PGC) in serum has been investigated as a potential biomarker for distinguishing between different types of gastritis and for assessing the risk of progression to gastric cancer.

For such research, it is critical to use well-validated PGA3 antibodies with demonstrated specificity, as cross-reactivity with other pepsinogens could confound results. Researchers should also consider the effects of Helicobacter pylori infection and proton pump inhibitor therapy on PGA3 expression when designing studies, as both can significantly alter pepsinogen levels independent of mucosal status.

How can I develop a multiplex assay for simultaneous detection of PGA3 and related biomarkers?

Developing a multiplex assay for simultaneous detection of PGA3 alongside other gastric biomarkers requires careful assay design and antibody selection. Begin by selecting antibodies against each target with minimal cross-reactivity and compatible working conditions. For PGA3, consider antibodies targeting unique epitopes with validated specificity .

For bead-based multiplex assays, conjugate different antibodies to spectrally distinct beads. For multiplex ELISA, use spatially separated capture antibodies on the same plate or spectrally distinct detection systems (different fluorophores or enzyme-substrate combinations). When developing sandwich-based assays, ensure that capture and detection antibodies recognize non-overlapping epitopes on PGA3.

Critical validation steps include: (1) Single-analyte standard curves to establish sensitivity for each biomarker independently, (2) Mixed-analyte standard curves to assess interference effects, (3) Spike-recovery experiments to evaluate matrix effects in biological samples, and (4) Cross-reactivity testing between all antibodies in the multiplex panel.

For gastritis research specifically, consider multiplexing PGA3 detection with other relevant biomarkers such as Pepsinogen C, Gastrin-17, H. pylori antibodies, or inflammatory cytokines. This approach provides a more comprehensive assessment of gastric pathophysiology than PGA3 alone, potentially improving diagnostic accuracy and research insights.

What are the optimal storage conditions for maintaining PGA3 antibody activity?

Proper storage of PGA3 antibodies is critical for maintaining their specificity and sensitivity over time. Most PGA3 antibodies should be stored at -20°C in their original formulation, which typically includes stabilizers like glycerol (40%) and preservatives like sodium azide (0.05%) . For long-term storage, aliquoting is essential to avoid repeated freeze-thaw cycles, which significantly degrade antibody performance. Each aliquot should be sufficient for a single experiment to minimize freeze-thaw cycles.

Working dilutions should be prepared fresh and can typically be stored at 4°C for no more than 1-2 weeks. For antibodies stored in glycerol, avoid centrifugation after thawing as this can create concentration gradients. If precipitation occurs, gentle warming to room temperature followed by mild vortexing can restore homogeneity without damaging the antibody.

Most manufacturers recommend avoiding more than 5 freeze-thaw cycles for any antibody preparation. Quality control testing should be performed periodically on stored antibodies, particularly for critical experiments. This can be done by testing the antibody against a known positive control sample and comparing performance to earlier results with the same antibody lot.

How should I validate a new lot of PGA3 antibody before use in critical experiments?

Systematic validation of new PGA3 antibody lots is essential for experimental reproducibility and reliability. Begin with basic quality control by visually inspecting the antibody solution for precipitates, discoloration, or contamination. Next, perform a titration experiment comparing the new lot with the previous lot at multiple dilutions (1:500, 1:1000, 1:2000, 1:5000) to determine if sensitivity or background levels have changed.

Western blot validation should include positive controls (gastric tissue or cell lines known to express PGA3) and negative controls (tissues or cells that don't express PGA3). Compare band intensity, molecular weight, and any non-specific bands between lots. For immunohistochemistry applications, stain serial sections from the same tissue block with both old and new lots, comparing staining pattern, intensity, and background.

Specificity validation should include peptide competition assays, where pre-incubation of the antibody with the immunizing peptide should abolish specific staining. For research detecting multiple pepsinogen family members, cross-reactivity testing against recombinant PGA3, PGA4, and PGA5 proteins is advisable.

Document all validation experiments, including images, for future reference. This documentation is particularly valuable for troubleshooting if performance issues arise later or for manuscript supplementary materials when publishing results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.