PGM1 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to PGM1 Antibody

Phosphoglucomutase 1 (PGM1) antibodies are specialized immunological tools designed to detect and quantify the PGM1 enzyme, a critical regulator of glucose metabolism. PGM1 catalyzes the reversible interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P), serving as a metabolic hub between glycogen synthesis and glycolysis . These antibodies are indispensable in studying PGM1’s role in diseases such as glycogen storage disorders (e.g., PGM1 deficiency, formerly GSD14) , cancer , and cardiomyopathy .

Key Applications in Biomedical Research

PGM1 antibodies are validated for diverse experimental applications, enabling researchers to investigate protein expression, localization, and function:

ApplicationDetails
Western Blot (WB)Detects PGM1 at ~61 kDa in human, mouse, and rat tissues/cells .
Immunohistochemistry (IHC)Identifies PGM1 expression patterns in paraffin-embedded tumor tissues .
Immunofluorescence (IF)Localizes PGM1 in cytoplasmic compartments .
ELISAQuantifies PGM1 levels in serum or lysates .
Immunoprecipitation (IP)Isolates PGM1 for interaction studies .

Cancer Biology

  • Hepatocellular Carcinoma (HCC): Overexpression of PGM1 suppresses tumor growth by redirecting glucose toward glycogenesis, as shown via IHC and WB in patient-derived xenografts .

  • Gastric Cancer (GC): PGM1 knockdown under glucose deprivation enhances orlistat’s antitumor effects, validated through WB and viability assays .

  • Colorectal Cancer (CRC): PGM1 inhibits CRC progression via the PI3K/AKT pathway, demonstrated through WB and IHC in clinical samples .

Metabolic Disorders

  • PGM1-CDG: Cardiac-specific PGM1 deficiency causes dilated cardiomyopathy (DCM), with glycogen accumulation and mitochondrial dysfunction revealed via IHC and WB in mouse models .

  • Therapeutic Interventions: AAV9-mediated PGM1 gene therapy restores cardiac function in Pgm2 knockout mice, monitored using antibodies in WB and histology .

Muscle Development

  • Myoblast Differentiation: PGM1 promotes myoblast proliferation and purine metabolism, as shown through WB and apoptosis assays in transfected cells .

Technical Considerations for Experimental Use

  • Storage: Most antibodies are stable at -20°C in glycerol-containing buffers . Avoid repeated freeze-thaw cycles.

  • Controls: Include PGM1-overexpressing or knockout cell lysates (e.g., SK-Hep1, HepG2) to validate specificity.

  • Cross-Reactivity: Confirm species reactivity; some antibodies (e.g., CAB21540 ) are human-specific, while others (e.g., ab192876 ) detect multiple species.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
PGM1 antibody; PGM antibody; I antibody; Phosphoglucomutase antibody; cytoplasmic antibody; PGM antibody; EC 5.4.2.2 antibody; Glucose phosphomutase antibody
Target Names
PGM1
Uniprot No.

Target Background

Function
PGM1 Antibody is an enzyme that plays a critical role in both the breakdown and synthesis of glucose.
Database Links

KEGG: sot:102579912

UniGene: Stu.18186

Protein Families
Phosphohexose mutase family
Subcellular Location
Cytoplasm.

Q&A

What is PGM1 and why is it a significant research target?

Phosphoglucomutase-1 (PGM1) is a key metabolic enzyme belonging to the phosphohexose mutase family. It catalyzes the reversible isomerization of alpha-D-glucose 1-phosphate to alpha-D-glucose 6-phosphate via an intermediate compound alpha-D-glucose 1,6-bisphosphate . This enzyme plays a crucial role in both the breakdown and synthesis of glucose, functioning as a metabolic switch between glycolysis and glycogenesis . In most cell types, PGM1 isozymes represent approximately 90% of total PGM activity, highlighting its biological significance . The enzyme interacts closely with other metabolic enzymes like glucose-6-phosphate dehydrogenase to ensure efficient energy regulation and metabolic flow within cells . Due to its central role in cellular metabolism, PGM1 has become a significant target for research in various disease contexts, including cancer metabolism.

What are the key specifications researchers should understand when selecting a PGM1 antibody?

When selecting a PGM1 antibody for research applications, researchers should consider several critical specifications:

SpecificationImportanceExamples from Available Antibodies
Host/IsotypeDetermines compatibility with secondary antibodies and experimental systemsMouse IgG2b (66105-1-Ig) , Rabbit IgG (ab192876) , Mouse IgG1 (CL3299)
ClonalityAffects specificity and consistencyMonoclonal for higher specificity and reproducibility
Validated ApplicationsEnsures antibody works in intended experimental contextsWB (1:2000-1:10000), IHC (1:50-1:500), IF/ICC (1:500-1:2000)
Species ReactivityDetermines compatibility with experimental modelsHuman, mouse, rat, rabbit, pig
Epitope RegionImportant for specific detection strategiesExample: amino acids SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD (for CL3299)
Molecular WeightFor verification of target detection61 kDa (calculated and observed)

Scientists should review validation data for each application they intend to use and select antibodies that have been rigorously tested in relevant experimental systems .

How does the structure and function of PGM1 relate to antibody epitope selection?

PGM1's structure-function relationship directly impacts antibody epitope selection strategies. PGM1 is a 61 kDa protein that catalyzes phosphate transfer between the 1 and 6 positions of glucose . When developing or selecting antibodies against PGM1, researchers must consider several structural factors. First, antibodies targeting conserved catalytic domains may offer broader cross-species reactivity, as evidenced by antibodies like 66105-1-Ig that react with human, mouse, rat, rabbit, and pig samples . Second, researchers investigating PGM1's enzymatic activity should select antibodies that do not interfere with the active site, unless inhibition studies are the objective. Third, some antibodies are specifically raised against fusion proteins containing particular PGM1 regions, such as the PGM1 fusion protein Ag7294 used for immunization in antibody 66105-1-Ig development . For studies examining PGM1's role in protein-protein interactions or specific cellular compartments, antibodies targeting accessible epitopes in the native conformation are preferable. Understanding these relationships helps researchers select antibodies appropriate for their specific research questions while avoiding epitopes that might be masked in experimental conditions .

What are the optimized protocols for PGM1 detection in Western blotting experiments?

For optimal Western blot detection of PGM1, researchers should follow these methodological guidelines:

  • Sample Preparation:

    • PGM1 is highly expressed in liver tissues and hepatocyte-derived cell lines such as HepG2, making these excellent positive controls .

    • Prepare lysates from cells or tissues using standard RIPA buffer supplemented with protease inhibitors.

    • Typical protein loading should be 20-30 μg of total protein per lane .

  • Electrophoresis and Transfer:

    • Use 10% SDS-PAGE gels for optimal separation around the 61 kDa molecular weight of PGM1 .

    • Transfer to PVDF or nitrocellulose membranes at 100V for 60-90 minutes.

  • Antibody Dilution and Incubation:

    • For primary antibody incubation, the following dilutions are recommended:

      • 66105-1-Ig: 1:2000-1:10000

      • ab192876: 1:10000

      • CL3299: 1 μg/ml

    • Use 5% non-fat dry milk in TBST as blocking/dilution buffer .

    • Incubate with primary antibody overnight at 4°C.

    • Use appropriate HRP-conjugated secondary antibodies at 1:1000-1:5000 dilution .

  • Detection and Verification:

    • PGM1 should be detected at approximately 61 kDa .

    • Multiple cell lines can be used to verify specificity, including HepG2, 293T, HeLa, and MDA-MB-231 cells .

    • Tissue lysates from human fetal liver, human fetal heart, and various animal liver tissues can serve as positive controls .

This protocol has been validated to detect PGM1 across multiple human and animal samples, ensuring reliable results for comparative studies .

How should researchers optimize immunohistochemistry (IHC) protocols for PGM1 detection in tissue samples?

Optimizing IHC protocols for PGM1 detection requires careful attention to several methodological considerations:

  • Tissue Processing and Preparation:

    • Formalin-fixed, paraffin-embedded (FFPE) tissues should be sectioned at 4-6 μm thickness.

    • Human liver and colon tissues serve as excellent positive controls for PGM1 expression .

  • Antigen Retrieval Methods:

    • Primary recommendation: TE buffer at pH 9.0 for heat-induced epitope retrieval .

    • Alternative method: Citrate buffer at pH 6.0 if TE buffer yields suboptimal results .

    • Heat treatment should be performed for 15-20 minutes at 95-100°C.

  • Antibody Selection and Dilution:

    • For standard IHC procedures, recommended dilutions vary by antibody:

      • 66105-1-Ig: 1:50-1:500

      • CL3299: 1:2500-1:5000

    • Begin with the median recommended dilution and adjust based on staining intensity and background.

  • Detection Systems and Controls:

    • Use DAB (3,3'-diaminobenzidine) as the chromogen for visualization.

    • Include appropriate negative controls (primary antibody omission and isotype controls).

    • For comparative studies of PGM1 expression in disease states, such as hepatocellular carcinoma (HCC), include both tumor and adjacent non-tumor tissues .

  • Scoring and Analysis:

    • Use semi-quantitative scoring methods to evaluate PGM1 expression, as validated in HCC studies .

    • When comparing PGM1 levels between different tissue types or disease states, standardize scoring criteria across all samples .

These optimized protocols have been validated in multiple studies, including research demonstrating that PGM1 expression is significantly lower in HCC tumor tissues compared to paired peritumoral tissues .

What are the critical considerations for immunofluorescence applications with PGM1 antibodies?

When performing immunofluorescence experiments with PGM1 antibodies, researchers should address these critical methodological considerations:

  • Cell Selection and Fixation:

    • HepG2 cells have been validated for PGM1 detection by immunofluorescence and serve as excellent positive controls .

    • For optimal results, fix cells with 4% paraformaldehyde for 15 minutes at room temperature, followed by permeabilization with 0.2-0.5% Triton X-100 for 5-10 minutes.

  • Antibody Dilution and Incubation:

    • For 66105-1-Ig antibody, use a dilution range of 1:500-1:2000 .

    • Block with 1-5% BSA or normal serum from the same species as the secondary antibody.

    • Incubate with primary antibody overnight at 4°C or for 1-2 hours at room temperature.

  • Co-localization Studies:

    • PGM1 primarily localizes to the cytoplasm, so researchers should consider this when designing co-localization experiments.

    • When performing multi-color immunofluorescence, select primary antibodies raised in different host species to avoid cross-reactivity.

    • Include appropriate subcellular markers to establish PGM1's precise intracellular distribution.

  • Signal Amplification and Detection:

    • Use fluorophore-conjugated secondary antibodies with excitation/emission spectra compatible with available microscopy equipment.

    • For weak signals, consider tyramide signal amplification systems.

    • Include DAPI or Hoechst staining for nuclear visualization to facilitate interpretation of PGM1's cytoplasmic localization.

  • Controls and Validation:

    • Include technical controls (primary antibody omission, isotype controls).

    • For definitive validation of specificity, include cells with PGM1 knockdown or knockout as negative controls .

    • When evaluating PGM1's role in metabolic pathways, consider co-staining with other metabolic enzymes to assess potential colocalization.

By following these guidelines, researchers can achieve reliable and reproducible immunofluorescence results when studying PGM1 expression and localization in different cellular contexts .

How does PGM1 expression correlate with disease progression in hepatocellular carcinoma?

Research has revealed significant correlations between PGM1 expression and hepatocellular carcinoma (HCC) progression, providing important insights for cancer metabolism research:

  • Differential Expression Patterns:

    • Immunohistochemistry studies on 69 pairs of HCC tumor tissues and corresponding peritumoral tissues demonstrated significantly lower PGM1 expression in tumor tissues .

    • Further analyses of 272 HCC patients showed markedly reduced PGM1 expression in tumors from patients with microvascular invasion, suggesting a correlation with tumor aggressiveness .

  • Patient-Derived Xenograft (PDX) Models:

    • Examination of 17 HCC PDX tumors revealed that tumors with low PGM1 expression (n=12) exhibited more rapid progression than those with high PGM1 expression (n=5) .

    • This inverse correlation between PGM1 levels and tumor growth rates provides strong evidence for PGM1's tumor-suppressive role in HCC .

  • Correlation with Clinical Parameters:

    • PGM1 expression shows a significant inverse correlation with HCC malignancy parameters, suggesting its potential as a prognostic biomarker .

    • Studies indicate that PGM1's enzymatic activity correlates with its protein levels in primary tumors and cell lines, emphasizing the functional significance of PGM1 downregulation in HCC .

  • Relationship with Oncogenes and Tumor Suppressors:

    • Transcriptional analyses revealed that PGM1 mRNA expression shows no or low correlation with several commonly altered oncogenes and tumor suppressors in HCC, including CTNNB1 (r=0.255), MYC (r=0.009), IGF2 (r=-0.276), TGFA (r=-0.288), TP53 (r=-0.374), and RB1 (r=-0.11) .

    • PGM1 mRNA expression was slightly higher in samples with mutant CTNNB1 compared to wild-type CTNNB1, but showed no difference between wild-type and mutant TP53 samples .

These findings collectively demonstrate that PGM1 functions as a tumor suppressor in HCC, with its downregulation associated with increased tumor aggressiveness and poorer prognosis .

What is the functional significance of PGM1's metabolic activity in cancer cell metabolism?

PGM1's metabolic activity plays a critical role in cancer cell metabolism, with significant implications for tumor growth and progression:

  • Metabolic Reprogramming in Cancer:

    • PGM1 catalyzes the reversible conversion between glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P), functioning as a key metabolic switch between glycolysis and glycogenesis pathways .

    • In HCC, PGM1 overexpression significantly elevates the G-1-P/G-6-P ratio, redirecting glucose metabolism from glycolysis toward glycogenesis .

    • This metabolic shift directly impacts cancer cell energy production and biosynthetic capabilities.

  • Impact on Glycolysis and Lactate Production:

    • Experimental evidence demonstrates that PGM1 overexpression in HCC cells substantially decreases lactate levels in tumors, indicating reduced glycolytic activity .

    • Conversely, PGM1 depletion significantly increases lactate production, promoting the Warburg effect characteristic of many cancer cells .

    • This modulation of glycolytic flux directly influences cancer cell proliferation and survival.

  • Regulation of Glycogen Metabolism:

    • PGM1 overexpression in tumor xenograft models increases glycogen levels, while PGM1 depletion decreases glycogen content .

    • This regulatory effect on glycogen metabolism represents an important mechanism by which PGM1 can suppress tumor growth by redirecting glucose from energy production to storage.

  • Enzymatic Activity Requirements for Tumor Suppression:

    • Studies using enzyme-dead PGM1 mutants (G121R) demonstrate that PGM1's enzymatic activity is essential for its tumor-suppressive functions .

    • Rescue experiments showed that wild-type PGM1, but not the enzymatically inactive G121R mutant, abrogated the increased proliferation, colony formation, and tumor growth associated with PGM1 depletion .

These findings establish PGM1 as a metabolic tumor suppressor in HCC, functioning by switching cellular metabolism from glycolysis to glycogenesis. This metabolic reprogramming antagonizes the Warburg effect commonly observed in cancer cells, inhibiting tumor cell proliferation and HCC development .

How should researchers interpret PGM1 antibody data in the context of metabolic pathway analyses?

When interpreting PGM1 antibody data in metabolic pathway analyses, researchers should consider several critical factors:

  • Integration with Enzymatic Activity Measurements:

    • PGM1 protein levels detected by antibodies should be correlated with enzymatic activity measurements since protein expression and functional activity may not always directly correlate .

    • Studies have confirmed that PGM1 enzymatic activity generally correlates with its protein levels in both primary tumors and cell lines, providing validation for using antibody-based detection as a proxy for metabolic function .

  • Context of Glycolytic and Glycogenic Pathways:

    • PGM1 antibody data should be interpreted alongside measurements of:

      • Glucose-1-phosphate/glucose-6-phosphate ratios (G-1-P/G-6-P)

      • Lactate levels (indicator of glycolytic activity)

      • Glycogen content (indicator of glycogenesis)

    • These complementary measurements provide a comprehensive view of how PGM1 expression affects glucose flux through different metabolic pathways.

  • Consideration of Tissue-Specific Expression Patterns:

    • PGM1 expression varies significantly across tissues, with particularly high expression in liver and heart tissues .

    • When comparing PGM1 levels across different tissue types, researchers should account for these tissue-specific baseline expression patterns.

    • For example, in red blood cells, PGM1 isozymes represent a smaller proportion of total PGM activity compared to other cell types, where they account for approximately 90% of total activity .

  • Relationship with Other Metabolic Enzymes:

    • PGM1 interacts with other enzymes in glucose metabolism pathways, such as glucose-6-phosphate dehydrogenase, ensuring efficient energy regulation and metabolic flow .

    • Comprehensive interpretation requires consideration of these enzymatic interactions and potential compensatory mechanisms.

    • Multi-antibody panels detecting several metabolic enzymes can provide more complete insights into metabolic pathway alterations.

  • Functional Validation Through Genetic Manipulation:

    • To definitively establish PGM1's metabolic roles, antibody detection should be complemented with functional studies using genetic approaches:

      • Overexpression systems to assess gain-of-function effects

      • shRNA-mediated depletion to evaluate loss-of-function consequences

      • Rescue experiments with wild-type versus enzymatically inactive mutants (e.g., G121R) to determine the importance of catalytic activity

By integrating PGM1 antibody data with these complementary approaches, researchers can more accurately interpret PGM1's role in metabolic reprogramming and its implications for disease states such as cancer .

What are the most common technical challenges with PGM1 antibody applications and how can they be resolved?

Researchers working with PGM1 antibodies may encounter several technical challenges that require specific troubleshooting approaches:

  • Western Blot Detection Issues:

    • Challenge: Weak or absent PGM1 signal despite proper loading controls.
      Solution: Optimize protein extraction using RIPA buffer supplemented with protease inhibitors. For liver samples, consider specialized liver tissue lysis buffers to manage high protein content. Increase antibody concentration incrementally (starting with 1:2000 dilution for 66105-1-Ig) or extend primary antibody incubation to overnight at 4°C.

    • Challenge: Multiple bands or non-specific binding.
      Solution: Increase blocking stringency using 5% NFDM/TBST . Optimize antibody dilution (consider 1:10000 for ab192876 for cleaner results) . Verify transfer efficiency with reversible protein stains before immunoblotting.

  • Immunohistochemistry Optimization:

    • Challenge: Weak or inconsistent staining in FFPE tissues.
      Solution: Prioritize antigen retrieval optimization. Begin with TE buffer (pH 9.0) as recommended for PGM1 antibodies, but have citrate buffer (pH 6.0) as an alternative . Extend retrieval time to 20-30 minutes if initial results are weak.

    • Challenge: High background staining.
      Solution: Titrate primary antibody carefully (begin with 1:100 for 66105-1-Ig or 1:5000 for CL3299) . Extend blocking time to 1-2 hours with serum from the same species as the secondary antibody. Consider using commercial background-reducing reagents.

  • Immunofluorescence Specificity Issues:

    • Challenge: Diffuse cytoplasmic staining making interpretation difficult.
      Solution: Optimize fixation protocols (4% PFA for 10-15 minutes). Use confocal microscopy for better resolution of subcellular localization. Include appropriate cellular compartment markers to provide context for PGM1 localization.

    • Challenge: Autofluorescence interfering with signal interpretation.
      Solution: Include unstained controls to assess autofluorescence levels. Consider tissue-specific autofluorescence quenching reagents. Use spectral unmixing on confocal microscopes if available.

  • Cross-Species Reactivity Verification:

    • Challenge: Uncertain antibody performance in non-human samples.
      Solution: Despite manufacturer claims of reactivity with multiple species , verify reactivity in each specific experimental system. Include positive control tissues (liver samples from the target species) . Consider using species-specific positive controls that naturally express high levels of PGM1, such as liver tissue from mouse, rat, rabbit, or pig .

By systematically addressing these common challenges, researchers can optimize their PGM1 antibody protocols for consistent, specific, and sensitive detection across multiple applications .

How can researchers validate PGM1 antibody specificity for their particular experimental system?

Rigorous validation of PGM1 antibody specificity is critical for generating reliable experimental data. Researchers should implement the following comprehensive validation strategy:

  • Molecular Weight Verification:

    • Compare observed bands in Western blots with the expected molecular weight of PGM1 (61 kDa) .

    • Perform gradient gels to better resolve PGM1 from similarly sized proteins.

    • Verify that the observed molecular weight is consistent across different sample types (cell lines, tissues) .

  • Genetic Manipulation Controls:

    • Implement PGM1 knockdown or knockout systems as definitive negative controls:

      • Use shRNA-mediated depletion of PGM1 in cell lines and verify reduced signal intensity .

      • If available, use CRISPR/Cas9-generated PGM1 knockout cells as the gold standard negative control.

    • Perform overexpression of tagged PGM1 and confirm co-localization of the antibody signal with the tag .

  • Peptide Competition Assays:

    • Pre-incubate the PGM1 antibody with excess recombinant PGM1 protein or immunizing peptide.

    • Compare staining patterns between blocked and unblocked antibody samples.

    • Specific signals should be significantly reduced or eliminated in the presence of competing antigen, as validated in previous studies .

  • Multi-antibody Validation:

    • Compare staining patterns using different PGM1 antibodies targeting distinct epitopes:

      • 66105-1-Ig (Proteintech)

      • ab192876 [EPR15241] (Abcam)

      • CL3299 (Novus Biologicals)

    • Concordance between antibodies targeting different epitopes strongly supports specificity.

  • Positive and Negative Control Tissues:

    • Include known high-expressing tissues as positive controls:

      • Human, mouse, rat, rabbit, or pig liver tissues

      • Human fetal liver and heart tissues

    • Include tissues known to express low levels of PGM1 as comparative controls.

    • For IHC applications, compare staining in tumor tissues and paired peritumoral tissues, which should show differential expression patterns .

  • Cross-reactivity Assessment:

    • Verify the absence of significant signals in tissues from PGM1 knockout models if available.

    • For antibodies claiming multi-species reactivity, systematically test reactivity in each species of interest .

  • Application-specific Validation:

    • For Western blot: Perform reducing and non-reducing conditions to assess epitope accessibility.

    • For IHC/IF: Test multiple fixation and antigen retrieval methods to optimize specific signal while minimizing background .

By implementing this systematic validation approach, researchers can establish high confidence in the specificity of their PGM1 antibody detection system, enabling reliable interpretation of experimental results across different applications and model systems .

What are the recommended storage and handling practices to maintain PGM1 antibody performance over time?

To ensure optimal PGM1 antibody performance and longevity, researchers should adhere to these evidence-based storage and handling recommendations:

  • Temperature-Specific Storage Guidelines:

    • Short-term storage (up to 1 month): Store at 4°C as recommended for antibodies like CL3299 .

    • Long-term storage: Store at -20°C, which maintains antibody stability for commonly used PGM1 antibodies .

    • Avoid -80°C storage unless specifically recommended by the manufacturer, as repeated freezing and thawing between -80°C and working temperature can accelerate antibody degradation.

  • Aliquoting Strategy:

    • Upon receipt, prepare small single-use aliquots (10-20 μl) of undiluted antibody to minimize freeze-thaw cycles .

    • For antibodies in glycerol-containing buffers (like 66105-1-Ig in PBS with 50% glycerol), aliquoting may be less critical as these formulations better withstand multiple freeze-thaw cycles .

    • Label each aliquot with antibody name, lot number, date, and initial concentration.

  • Buffer and Additive Considerations:

    • Most commercial PGM1 antibodies are supplied in optimized buffer systems:

      • 66105-1-Ig: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3

      • CL3299: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

    • These formulations maintain antibody stability and prevent microbial contamination.

    • For working dilutions, prepare fresh on the day of use rather than storing diluted antibodies.

  • Freeze-Thaw Management:

    • Minimize freeze-thaw cycles as they can lead to antibody denaturation and reduced performance.

    • For 66105-1-Ig specifically, manufacturer data indicates stability for up to one year after shipment when stored properly at -20°C .

    • When thawing, allow antibodies to fully thaw at 4°C rather than at room temperature to minimize potential degradation.

  • Contamination Prevention:

    • Use sterile technique when handling antibody stock solutions.

    • Never pipette directly from the original antibody vial; instead, briefly centrifuge the vial before opening and remove the required volume without touching the pipette tip to the solution.

    • Replace caps tightly after use to prevent evaporation and contamination.

  • Working Dilution Handling:

    • For complex experiments, prepare master mixes of diluted antibody to ensure consistency across samples.

    • Add carrier proteins (0.1-0.5% BSA) to diluted antibodies when preparing working solutions for enhanced stability.

    • Discard unused diluted antibody rather than returning it to the stock.

  • Lot-to-Lot Consistency Verification:

    • When receiving a new lot of PGM1 antibody, perform side-by-side comparison with the previous lot using standard positive controls.

    • Document lot-specific optimal dilutions, as these may vary slightly between manufacturing batches.

By following these comprehensive storage and handling practices, researchers can maximize PGM1 antibody performance and longevity, ensuring consistent and reliable results across experiments .

How are PGM1 antibodies being utilized in cancer metabolism research beyond hepatocellular carcinoma?

While hepatocellular carcinoma has been a primary focus of PGM1 research, PGM1 antibodies are increasingly being applied to investigate metabolic reprogramming across diverse cancer types:

  • Metabolic Profiling Across Cancer Types:

    • PGM1 antibodies enable researchers to conduct comparative analyses of glucose metabolism across different tumor types, potentially identifying cancer-specific metabolic vulnerabilities.

    • The established protocols for PGM1 detection in liver cancer can be adapted for investigating other malignancies where metabolic reprogramming is a critical feature .

    • Researchers are using PGM1 immunohistochemistry to assess whether the inverse correlation between PGM1 expression and malignancy observed in HCC extends to other cancer types.

  • Integration with Multi-omics Approaches:

    • PGM1 antibody-based tissue analyses are being combined with transcriptomics, proteomics, and metabolomics to provide comprehensive metabolic profiles of tumors.

    • This integration helps researchers understand how altered PGM1 expression affects global metabolic networks beyond glycolysis and glycogenesis.

    • The established protocols for PGM1 antibody applications provide reliable protein-level data to complement other omics approaches .

  • Therapeutic Response Prediction:

    • Given PGM1's role in metabolic switching, antibody-based detection of PGM1 levels may help predict tumor responses to metabolism-targeting therapies.

    • Researchers are investigating whether PGM1 expression levels, as detected by validated antibodies, can serve as biomarkers for sensitivity to glycolysis inhibitors or other metabolic interventions.

    • The standardized protocols for PGM1 detection enable reliable assessment of PGM1 in pre-treatment biopsies and resection specimens .

  • Investigation of Tumor Heterogeneity:

    • PGM1 antibodies enable spatial analysis of metabolic heterogeneity within tumors through techniques like multiplexed immunohistochemistry.

    • By combining PGM1 antibodies with markers of proliferation, hypoxia, and other metabolic enzymes, researchers can map metabolic territories within the tumor microenvironment.

    • The validated immunohistochemistry protocols provide reliable means to assess this heterogeneity .

  • Exploration of PGM1's Role in Cancer Stem Cells:

    • Emerging research is utilizing PGM1 antibodies to investigate whether cancer stem cell populations exhibit distinct PGM1 expression patterns compared to bulk tumor cells.

    • The established immunofluorescence protocols for PGM1 detection can be combined with cancer stem cell markers to address this question .

These expanding applications of PGM1 antibodies in cancer metabolism research highlight the importance of validated detection methods in understanding metabolic reprogramming as a fundamental aspect of cancer biology .

What are the technical considerations for using PGM1 antibodies in multiplex immunoassays?

Incorporating PGM1 antibodies into multiplex immunoassays requires careful technical considerations to ensure reliable, specific detection alongside other targets:

  • Antibody Selection for Multiplexing:

    • Choose PGM1 antibodies raised in different host species than other target antibodies to facilitate simultaneous detection.

    • For multiplex immunofluorescence, select monoclonal PGM1 antibodies like 66105-1-Ig (Mouse IgG2b) or ab192876 (Rabbit IgG) based on compatibility with other antibodies in the panel.

    • Verify that the selected PGM1 antibody maintains specificity when used in combination with other antibodies and detection reagents.

  • Signal Separation Strategies:

    • For fluorescence-based multiplexing, ensure that fluorophores conjugated to secondary antibodies have minimal spectral overlap.

    • Consider sequential detection approaches when using multiple antibodies of the same species:

      • Apply tyramide signal amplification (TSA) to the first primary antibody.

      • Strip or quench the first primary antibody before applying the second.

      • This approach is particularly useful when combining PGM1 detection with other metabolic enzymes.

  • Optimization of Multiplex Protocols:

    • Perform single-plex optimization before combining antibodies:

      • Determine optimal dilutions for the PGM1 antibody in isolation (e.g., 1:500-1:2000 for IF/ICC using 66105-1-Ig) .

      • Validate each antibody individually on positive and negative control samples.

    • When combining antibodies, re-optimize dilutions as antibodies may behave differently in multiplex formats.

    • Test for potential cross-reactivity between primary and secondary antibodies in the multiplex panel.

  • Antigen Retrieval Compatibility:

    • Ensure that all antibodies in the multiplex panel are compatible with the same antigen retrieval method.

    • For PGM1 antibodies, TE buffer at pH 9.0 is recommended for antigen retrieval, with citrate buffer at pH 6.0 as an alternative .

    • If antibodies require different retrieval conditions, consider sequential multiplexing protocols with intermediate fixation steps.

  • Image Acquisition and Analysis Considerations:

    • Use proper controls to correct for autofluorescence and spectral bleed-through.

    • For confocal microscopy, perform sequential scanning rather than simultaneous acquisition to minimize crosstalk.

    • Implement quantitative image analysis to assess colocalization or mutual exclusivity of PGM1 with other markers.

  • Validation of Multiplex Results:

    • Confirm multiplex findings with single-plex staining on serial sections.

    • Use alternative methods (e.g., Western blotting) to verify key findings from multiplex immunoassays.

    • Consider biological validation through functional studies that manipulate PGM1 expression .

By addressing these technical considerations, researchers can successfully incorporate PGM1 antibodies into multiplex immunoassays, enabling comprehensive analysis of metabolic pathways and their relationship to other cellular processes in normal and diseased tissues .

How might advances in antibody technology enhance future PGM1 research?

Emerging antibody technologies promise to significantly enhance PGM1 research through several innovative approaches:

  • Next-Generation Recombinant Antibodies:

    • Development of synthetic recombinant antibodies with improved specificity and batch-to-batch consistency will address current challenges in reproducibility.

    • Engineered antibody fragments (Fabs, scFvs) with enhanced tissue penetration properties may improve detection of PGM1 in complex tissue specimens.

    • Humanized recombinant antibodies against PGM1 could facilitate translation from research to potential diagnostic applications.

  • Advanced Modification Technologies:

    • Site-specific conjugation methods will enable precise addition of fluorophores or other detection moieties without compromising antibody binding properties.

    • Bifunctional antibodies targeting PGM1 and other metabolic enzymes simultaneously could provide new insights into metabolic enzyme interactions.

    • Antibody engineering to create pH-sensitive or environmentally responsive PGM1 antibodies would enable dynamic monitoring of PGM1 in living systems.

  • Integration with Emerging Detection Platforms:

    • Adaptation of PGM1 antibodies for super-resolution microscopy techniques will provide unprecedented insights into PGM1's subcellular localization and potential compartmentalization.

    • Compatibility with spatial transcriptomics platforms will allow correlation between PGM1 protein expression and local transcriptional programs.

    • Development of antibodies compatible with expansion microscopy protocols will enhance visualization of PGM1's spatial relationships with other cellular components.

  • Functional Antibody Developments:

    • Engineering of conformation-specific antibodies that can distinguish between active and inactive forms of PGM1 would provide direct insights into enzyme regulation.

    • Development of antibodies that specifically recognize post-translational modifications of PGM1 would enable studies of how these modifications affect enzymatic activity.

    • Creation of intrabodies (intracellular antibodies) against PGM1 would allow manipulation of PGM1 function in living cells.

  • High-Throughput and Automation-Compatible Formats:

    • Adaptation of PGM1 antibodies for microfluidic-based assays will facilitate high-throughput screening of PGM1 modulators.

    • Development of antibody formats compatible with automated immunostaining platforms will enhance reproducibility and throughput in clinical research settings.

These technological advances will collectively expand the capabilities for PGM1 detection and functional analysis, enabling more sophisticated investigations into PGM1's role in normal physiology and disease states .

What are the most promising directions for future research on PGM1's role in disease mechanisms?

Based on current evidence and emerging research trends, several promising directions for future PGM1 research warrant investigation:

  • Expanded Cancer Metabolism Studies:

    • Extension of PGM1's tumor-suppressive role beyond hepatocellular carcinoma to other cancer types using established antibody-based detection methods .

    • Investigation of how PGM1-mediated metabolic reprogramming affects tumor microenvironment and immune cell function.

    • Exploration of potential therapeutic approaches targeting the PGM1 pathway to reverse the Warburg effect in cancer cells .

  • Metabolic Disease Connections:

    • Systematic investigation of PGM1's role in metabolic disorders beyond known associations with glycogen storage diseases.

    • Examination of how PGM1 expression patterns change in conditions like diabetes, obesity, and non-alcoholic fatty liver disease.

    • Exploration of potential connections between PGM1 polymorphisms and susceptibility to metabolic disorders.

  • Regulatory Mechanisms:

    • Identification of transcriptional, post-transcriptional, and post-translational mechanisms regulating PGM1 expression and activity.

    • Investigation of how cellular stress conditions affect PGM1 expression and function.

    • Characterization of protein-protein interactions involving PGM1 that might modulate its enzymatic activity or cellular localization.

  • Therapeutic Targeting Strategies:

    • Development of small molecule activators of PGM1 as potential therapeutics for cancers where PGM1 acts as a tumor suppressor .

    • Exploration of metabolic vulnerability created by PGM1 deficiency in certain cancer contexts.

    • Investigation of combination therapies targeting PGM1-related metabolic pathways alongside conventional cancer treatments.

  • Systems Biology Approaches:

    • Integration of PGM1 into comprehensive metabolic network models to predict systemic effects of PGM1 alterations.

    • Multi-omics analyses to understand how PGM1 expression correlates with global metabolic profiles across different tissues and disease states.

    • Application of machine learning approaches to identify novel associations between PGM1 expression patterns and disease phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.