At1g07170 Antibody

What is the At1g07170 gene and what protein does it encode?

At1g07170 is a gene in Arabidopsis thaliana that encodes the PHD finger-like domain-containing protein 5B. This protein is relatively small with a length of 110 amino acids and has multiple cross-references in protein databases (NP_001077473.1, NP_001184928.1, NP_563782.1, NP_565691.1) . The protein sequence is: MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR . As a PHD finger-containing protein, it likely plays a role in protein-protein interactions, potentially in chromatin regulation or transcriptional processes, though specific functions may require further characterization in research contexts.

What types of At1g07170 antibodies are available for research?

Several formats of antibodies targeting the At1g07170 gene product (UniProt ID: Q0WMV8) are available for research purposes:

Each antibody combination is generated against three synthetic peptides representing different regions of the target protein . Additionally, commercial sources like CUSABIO offer antibodies (catalog number CSB-PA938206XA01DOA) specifically designed for the Q0WMV8 protein .

How can I verify the specificity of At1g07170 antibodies?

Verifying antibody specificity for At1g07170 requires multiple methodological approaches. First, perform Western blot analysis using both wild-type Arabidopsis extracts and knockout/knockdown lines (if available) to confirm the presence and absence of specific bands, respectively. The expected molecular weight of the PHD finger-like domain-containing protein 5B is approximately 12.4 kDa based on its 110 amino acid sequence .

Second, conduct immunoprecipitation followed by mass spectrometry to confirm that the precipitated protein matches At1g07170. Third, utilize recombinant At1g07170 protein as a positive control and for antibody pre-absorption tests to verify specificity. Following protocols similar to those used for histone antibody validation in Arabidopsis research, where antibodies are tested against specific mutants, would provide robust validation . Document antibody dilutions, incubation conditions, and detection methods carefully to ensure reproducibility of results.

What are recommended protocols for using At1g07170 antibodies in Western blot analysis?

For optimal Western blot results with At1g07170 antibodies, follow this methodological approach:

• Sample preparation: Extract total protein from Arabidopsis seedlings by snap-freezing in liquid nitrogen and grinding approximately 50 mg tissue in 4× Laemmli sample buffer followed by boiling .

• Gel electrophoresis: Use 15% acrylamide gels for optimal resolution of the relatively small (~12.4 kDa) At1g07170 protein .

• Transfer: Utilize a rapid transfer system such as the Bio-Rad Trans-Blot Turbo system for efficient protein transfer to membranes .

• Blocking and antibody incubation:

  • Block membrane in 5% non-fat dry milk in TBST for 1 hour at room temperature

  • Incubate with At1g07170 antibody (X-Q0WMV8-N, X-Q0WMV8-C, or X-Q0WMV8-M) at 1:1000 dilution overnight at 4°C

  • Wash 3× with TBST for 10 minutes each

  • Incubate with secondary antibody conjugated to HRP at 1:5000 dilution

• Detection: Use a chemiluminescence detection system such as Bio-Rad ChemiDoc for visualization .

• Quantification: Analyze band intensity using ImageJ software for accurate quantification .

Include appropriate controls such as loading controls (anti-UGPase at 1:1000 dilution) and, if available, extracts from At1g07170 mutant plants .

How can At1g07170 antibodies be applied in chromatin immunoprecipitation (ChIP) experiments?

When using At1g07170 antibodies for ChIP experiments in Arabidopsis, researchers should adapt standard plant ChIP protocols with the following specific considerations:

• Tissue collection and crosslinking: Harvest Arabidopsis seedlings 3 days after sowing and crosslink immediately with 1% formaldehyde for 10 minutes under vacuum to preserve protein-DNA interactions .

• Chromatin preparation: Isolate nuclei, followed by sonication to fragment chromatin to 200-500 bp fragments. Verify fragmentation efficiency by agarose gel electrophoresis.

• Immunoprecipitation:

  • Pre-clear chromatin with protein A/G beads

  • Incubate pre-cleared chromatin with At1g07170 antibody (2-5 μg) overnight at 4°C

  • Include appropriate controls: IgG negative control and positive control antibodies (such as anti-H3K9K14Ac or anti-H3K27me3)

  • Collect immunocomplexes with protein A/G beads

• Washing and elution: Perform stringent washes with increasing salt concentrations to reduce non-specific binding, followed by elution of immunocomplexes.

• Reverse crosslinking and DNA purification: Incubate samples at 65°C overnight to reverse crosslinks, then purify DNA using standard phenol-chloroform extraction or commercial kits.

• qPCR analysis: Design primers to amplify regions of interest based on the hypothesized function of At1g07170 protein, potentially focusing on genes involved in stress response pathways similar to those regulated by HDC1 .

Since PHD finger domains often recognize specific histone modifications, examining co-localization with specific histone marks (like H3K9K14Ac or H3K27me3) would provide valuable insights into At1g07170 function .

How can I investigate potential interactions between At1g07170 and histone modification complexes?

Given the PHD finger domain in At1g07170 protein and the known involvement of similar proteins in epigenetic regulation, investigating interactions with histone modification complexes requires a multi-faceted approach:

• Co-immunoprecipitation (Co-IP):

  • Perform protein extraction from Arabidopsis seedlings using a buffer that preserves protein-protein interactions

  • Immunoprecipitate with anti-At1g07170 antibodies

  • Analyze pulled-down proteins by mass spectrometry or Western blot, looking specifically for components of histone deacetylase complexes (like HDC1) or other chromatin modifiers

• Yeast two-hybrid or split-luciferase assays to verify direct protein-protein interactions between At1g07170 and candidate interactors.

• ChIP-reChIP experiments:

  • Perform sequential ChIP using anti-At1g07170 antibody followed by antibodies against histone modifications (such as H3K9K14Ac or H3K27me3)

  • This approach can determine if At1g07170 co-localizes with specific histone marks at genomic loci

• Chromatin association analysis under stress conditions:

  • Compare At1g07170 binding profiles in control versus salt-stressed seedlings

  • Determine if At1g07170 associates with stress-responsive genes similar to those regulated by HDC1-dependent mechanisms

• Genetic interaction studies:

  • Generate double mutants of At1g07170 with known chromatin modifiers (e.g., hdc1-1)

  • Analyze phenotypes under normal and stress conditions to identify genetic interactions

This comprehensive approach can reveal whether At1g07170 functions in epigenetic regulation similar to the HDC1 complex that moderates stress responses in Arabidopsis .

What experimental approaches can determine if At1g07170 is involved in stress response pathways?

To investigate At1g07170's potential role in stress response pathways, particularly in relation to epigenetic regulation similar to HDC1 , implement these methodological strategies:

• Transcriptome analysis:

  • Compare RNA-seq profiles of wild-type and At1g07170 mutant seedlings under control and stress conditions (e.g., salt stress)

  • Focus analysis on stress-responsive genes, particularly those known to be regulated by epigenetic mechanisms

• ChIP-seq analysis:

  • Perform genome-wide mapping of At1g07170 binding sites using ChIP-seq

  • Compare binding profiles under normal and stress conditions

  • Correlate binding with changes in histone modifications (H3K9K14Ac, H3K27me3) and gene expression

• Phenotypic characterization:

  • Analyze seed germination and seedling establishment of At1g07170 mutants under salt stress conditions

  • Score percentage of established seedlings 6 days after sowing on media containing various NaCl concentrations

  • Compare with wild-type and known stress response mutants (e.g., hdc1-1)

• Protein-level regulation:

  • Examine At1g07170 protein abundance and post-translational modifications in response to stress using Western blot analysis

  • Investigate potential changes in subcellular localization using immunofluorescence microscopy

• Genetic complementation:

  • Create transgenic lines expressing At1g07170 under its native promoter in the mutant background

  • Test whether wild-type phenotype is restored under stress conditions

  • Generate truncated versions to identify functional domains important for stress response

This systematic approach can determine whether At1g07170, like HDC1, functions as an "anti-panic" device that tunes stress responsiveness in Arabidopsis .

How can I optimize immunoprecipitation protocols for At1g07170 antibodies?

Optimizing immunoprecipitation (IP) protocols for At1g07170 antibodies requires careful attention to several critical parameters:

• Antibody selection and validation:

  • Compare efficiency of N-terminal (X-Q0WMV8-N) versus C-terminal (X-Q0WMV8-C) antibodies for IP applications

  • Validate antibody specificity using recombinant protein or knockout lines before proceeding

• Extraction buffer optimization:

  • Test different extraction buffers varying in salt concentration (150-500 mM NaCl) and detergent type/concentration

  • For nuclear proteins like At1g07170, include DNase I treatment to release chromatin-bound proteins

  • Consider adding protease inhibitors, phosphatase inhibitors, and HDAC inhibitors to preserve protein integrity and modification states

• Cross-linking considerations:

  • For transient interactions, perform in vivo crosslinking with formaldehyde (1-1.5%) or DSP (dithiobis-succinimidyl propionate)

  • Optimize crosslinking time (5-20 minutes) to preserve interactions without creating excessive crosslinks

• Antibody-to-protein ratio optimization:

  • Titrate antibody amount (1-10 μg) against a fixed amount of protein extract

  • Determine minimum antibody required for efficient pull-down using Western blot analysis

• Incubation conditions:

  • Compare overnight incubation at 4°C versus shorter incubations (2-4 hours)

  • Test rotation versus gentle rocking for mixing during incubation

• Washing stringency:

  • Develop a washing strategy with increasing salt concentrations (150-500 mM NaCl)

  • Include detergent (0.1-0.5% Triton X-100 or NP-40) in wash buffers

  • Determine optimal number of washes (3-6) to reduce background without losing specific interactions

• Elution methods:

  • Compare different elution strategies: low pH, high salt, SDS, or specific peptide competition

  • For subsequent mass spectrometry analysis, consider on-bead digestion to minimize contamination

Document all optimization steps and maintain consistent protocols once optimized to ensure reproducibility across experiments.

What are potential pitfalls when using At1g07170 antibodies in different experimental contexts?

When using At1g07170 antibodies across different experimental applications, researchers should be aware of these potential pitfalls and corresponding solutions:

• Cross-reactivity issues:

  • Problem: PHD finger domains share structural similarities, potentially causing antibody cross-reactivity with related proteins

  • Solution: Validate antibody specificity using At1g07170 knockout lines; perform peptide competition assays; confirm results with multiple antibodies targeting different regions (N-terminal vs. C-terminal)

• Epitope masking:

  • Problem: Post-translational modifications or protein-protein interactions may mask antibody epitopes

  • Solution: Test multiple antibodies targeting different regions; use denaturing conditions for Western blot; consider native vs. denatured applications carefully

• Low abundance challenges:

  • Problem: At1g07170 may be expressed at low levels or in specific tissues/conditions

  • Solution: Optimize protein extraction methods; concentrate samples before immunoprecipitation; consider using transgenic lines with tagged versions of At1g07170

• Developmental and stress-dependent expression:

  • Problem: Expression patterns may vary during development or stress conditions

  • Solution: Carefully time sample collection (e.g., 3 days after sowing for seedlings); document growth conditions precisely; include appropriate controls for stress treatments

• Fixation artifacts in immunohistochemistry:

  • Problem: Fixation can alter protein conformation or accessibility

  • Solution: Compare different fixation methods (paraformaldehyde, glutaraldehyde, methanol); optimize fixation time; include antigen retrieval steps

• Buffer incompatibilities:

  • Problem: Certain buffers may interfere with antibody binding

  • Solution: Test multiple buffer systems; avoid detergents for applications requiring native protein interactions; ensure pH compatibility with antibody specifications

• ChIP-specific challenges:

  • Problem: Inefficient chromatin fragmentation or high background

  • Solution: Optimize sonication conditions; increase wash stringency; use highly specific antibodies; include appropriate controls (IgG, input)

• Western blot detection issues:

  • Problem: Multiple bands or unexpected molecular weight

  • Solution: Include positive controls (recombinant protein); optimize gel percentage (15% for small proteins); consider protein modifications that might affect migration

Thorough documentation of experimental conditions and systematic troubleshooting are essential for addressing these potential pitfalls effectively.

How might new technologies enhance the study of At1g07170 function?

Emerging technologies offer powerful approaches to expand our understanding of At1g07170 function beyond traditional antibody-based methods:

• CRISPR/Cas9 genome editing:

  • Generate precise mutations in functional domains of At1g07170

  • Create tagged versions at endogenous loci for improved detection

  • Develop conditional knockout systems to study temporal functions

  • Previous attempts using pKIR1.1 vector systems provide methodological guidance for Arabidopsis gene editing

• Proximity-dependent labeling (BioID/TurboID):

  • Fuse At1g07170 with biotin ligase to identify proximal proteins in vivo

  • Map protein interaction networks under different stress conditions

  • Compare interactomes in different tissues or developmental stages

• Single-cell technologies:

  • Apply single-cell RNA-seq to identify cell-specific expression patterns

  • Use single-cell ATAC-seq to correlate chromatin accessibility with At1g07170 function

  • Implement spatial transcriptomics to map expression in tissue contexts

• Advanced imaging techniques:

  • Utilize super-resolution microscopy to visualize At1g07170 localization at subnuclear level

  • Apply FRET/FLIM to study protein-protein interactions in living cells

  • Implement light-sheet microscopy for dynamic studies in developing seedlings

• Integrative multi-omics approaches:

  • Combine ChIP-seq, RNA-seq, and proteomics data to create comprehensive models

  • Correlate At1g07170 binding with histone modifications and transcriptional outcomes

  • Apply computational approaches to predict regulatory networks involving At1g07170

• Synthetic biology approaches:

  • Design synthetic transcription factors based on At1g07170 domains

  • Create optogenetic versions to control At1g07170 function with light

  • Engineer synthetic circuits to test hypothesized functions

• Cryo-EM structural studies:

  • Determine high-resolution structure of At1g07170 alone and in complex with interaction partners

  • Identify structural changes upon binding to histone modifications or DNA

These advanced approaches can overcome limitations of antibody-based methods and provide deeper insights into the molecular mechanisms of At1g07170 function in epigenetic regulation and stress responses.