PHYH antibodies are immunological reagents designed to specifically detect and bind to phytanoyl-CoA 2-hydroxylase (PHYH), a peroxisomal enzyme involved in the alpha-oxidation of 3-methyl branched fatty acids. These antibodies serve as essential tools for studying PHYH expression, localization, and function across various experimental platforms including Western blotting, immunohistochemistry, and immunofluorescence. PHYH antibodies are available in both polyclonal and monoclonal formats, each with specific advantages for different research applications. The antibodies are typically raised in rabbit or mouse hosts against specific immunogens derived from human PHYH protein sequences .
PHYH antibodies have gained particular importance due to the enzyme's role in several metabolic disorders. The target protein, phytanoyl-CoA 2-hydroxylase, catalyzes the conversion of phytanoyl-CoA to 2-hydroxyphytanoyl-CoA, which represents the first step in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. This critical metabolic function has implications for several human diseases, making PHYH antibodies valuable research tools in pathophysiological studies .
PHYH plays a crucial role in lipid metabolism within peroxisomes. The enzyme specifically catalyzes the hydroxylation of not only racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA but also a variety of other mono-branched 3-methylacyl-CoA esters with a chain length of at least seven carbon atoms. Additionally, it can hydroxylate straight-chain acyl-CoA esters with a chain length exceeding four carbon atoms . This alpha-oxidation pathway is essential for processing branched-chain fatty acids like phytanic acid, which cannot undergo direct beta-oxidation due to their methyl branch at the beta position .
Mutations in the PHYH gene are associated with Refsum disease, a rare autosomal recessive disorder characterized by the accumulation of phytanic acid in plasma and tissues. Additionally, deficient PHYH protein activity has been linked to Zellweger syndrome and rhizomelic chondrodysplasia punctata, both serious peroxisomal disorders . Recent research has also identified altered PHYH expression in certain cancers, particularly clear cell renal cell carcinoma (ccRCC), suggesting a potential role in cancer biology .
PHYH antibodies are available as both polyclonal and monoclonal reagents. Polyclonal antibodies are more commonly available from commercial sources and typically derived from rabbit hosts, while monoclonal antibodies are primarily mouse-derived . Most commercial PHYH antibodies are provided in unconjugated format, though some are available in glycerol-containing formulations for enhanced stability .
Most PHYH antibodies are developed against specific immunogenic regions of the protein. For example, some antibodies target the amino acid sequence "LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRA" within the human PHYH protein . The selection of highly antigenic and conserved regions contributes to the specificity and cross-reactivity profiles of these antibodies.
Western blot represents one of the most common applications for PHYH antibodies. These antibodies typically detect bands at approximately 36 kDa, corresponding to the monomeric form of PHYH, and sometimes at 70 kDa, which may represent the dimeric form of the protein . Recommended dilutions for Western blot applications range from 1:100 to 1:1000, or 0.04-0.4 μg/mL, depending on the specific antibody and experimental conditions .
PHYH antibodies are frequently used for immunohistochemical analysis of both frozen and paraffin-embedded tissues. For paraffin sections, heat-induced epitope retrieval (HIER) at pH 6 is typically recommended . Immunohistochemistry with PHYH antibodies has revealed cytoplasmic localization in various cell types, consistent with the peroxisomal localization of the protein. Recommended dilutions for immunohistochemistry applications generally range from 1:50 to 1:200 .
In addition to Western blot and immunohistochemistry, PHYH antibodies are validated for various other applications:
| Application | Recommended Dilution Range |
|---|---|
| Western Blot | 1:100-1:1000 (or 0.04-0.4 μg/mL) |
| Immunohistochemistry | 1:50-1:200 |
| ELISA | 1:500-1:3000 |
| Immunofluorescence | 1:50-1:500 |
Recent research has identified significant associations between PHYH expression and cancer progression, particularly in clear cell renal cell carcinoma (ccRCC). A study using The Cancer Genome Atlas (TCGA) data revealed that PHYH expression is significantly lower in ccRCC compared to normal kidney tissues (p = 1.156e−19) . Furthermore, Kaplan-Meier survival analysis demonstrated that high expression of PHYH correlates with better prognosis compared to low expression (p = 9e−05) . These findings suggest potential prognostic value for PHYH expression analysis in ccRCC.
The relationship between PHYH expression and various clinical parameters in ccRCC has been investigated, revealing several significant associations:
| Clinical Characteristic | Relationship with PHYH Expression | p-value |
|---|---|---|
| Gender (Female vs. Male) | OR: 0.594 | 0.005 |
| Grade (G3-4 vs. G1-2) | OR: 0.591 | 0.003 |
| Stage (Stage I&II vs. Stage III&IV) | OR: 0.506 | <0.001 |
| T (T1-2 vs. T3-4) | OR: 0.529 | 0.001 |
These correlations indicate that decreased PHYH expression is associated with more advanced disease characteristics in ccRCC, supporting its potential role as a prognostic biomarker .
Gene Set Enrichment Analysis (GSEA) of PHYH expression in ccRCC has identified several metabolic pathways associated with PHYH expression levels, including butanoate metabolism, histidine metabolism, propanoate metabolism, pyruvate metabolism, tryptophan metabolism, PPAR signaling pathway, and the renin-angiotensin system . These findings suggest a broader role for PHYH in cellular metabolism beyond its established function in phytanic acid metabolism.
Investigation of gene-gene interactions has revealed associations between PHYH and several peroxin (PEX) genes, including PEX2, PEX7, PEX10, PEX13, and PEX14 . This interaction network underscores the functional integration of PHYH within the broader peroxisomal protein network and suggests potential cooperative roles in peroxisomal function and metabolic regulation.
The continued development and characterization of PHYH antibodies will likely facilitate further research into the role of this enzyme in both normal physiology and disease states. Emerging applications for PHYH antibodies include their use in multiplex immunoassays, single-cell protein analyses, and potentially as tools for developing diagnostic or prognostic tests for Refsum disease and certain cancers.
The association between PHYH expression and cancer prognosis, particularly in ccRCC, suggests potential clinical applications for PHYH antibodies in cancer biomarker research. Further investigation may reveal additional cancer types where PHYH expression has prognostic or predictive value, expanding the utility of these antibodies in oncology research and potentially clinical diagnostics.
Additionally, with the growing interest in peroxisomal disorders and lipid metabolism in various diseases, PHYH antibodies will continue to serve as essential tools for investigating the pathophysiological mechanisms underlying these conditions. The development of more specific, sensitive, and versatile PHYH antibodies will further enhance their utility in both basic research and clinical applications.
PHYH (Phytanoyl-CoA 2-hydroxylase), also known as Phytanic acid oxidase or Phytanoyl-CoA alpha-hydroxylase, is a peroxisomal enzyme that plays a crucial role in lipid metabolism. It catalyzes the first step in the alpha-oxidation of phytanic acid, converting phytanoyl-CoA to 2-hydroxyphytanoyl-CoA . This enzyme is critical for the metabolism of 3-methyl branched fatty acids in peroxisomes .
Research indicates that PHYH may also participate in determining the number of peroxisomes within cells and is involved in regulating their activities. Mutations in the PHYH gene can lead to serious conditions such as Refsum disease, while deficient protein activity has been associated with Zellweger syndrome and rhizomelic conditions .
PHYH antibodies have multiple validated research applications:
| Application | Validation Status | Samples |
|---|---|---|
| Western Blot (WB) | Validated (5 publications) | Human, mouse, rat |
| Immunohistochemistry (IHC) | Validated (1 publication) | Human kidney tissue |
| ELISA | Validated | Human, mouse, rat |
Positive Western Blot detection has been reported in human liver tissue, HEK-293 cells, human kidney tissue, and Jurkat cells . For IHC applications, successful results have been documented in human kidney tissue studies with specific antigen retrieval methods .
Optimal dilution ranges vary by application:
| Application | Recommended Dilution Range | Notes |
|---|---|---|
| Western Blot (WB) | 1:500-1:2000 | Sample-dependent |
| Immunohistochemistry (IHC) | 1:20-1:200 | Requires antigen retrieval |
These ranges serve as starting points, and researchers should titrate the antibody in their specific experimental systems to determine optimal conditions. For IHC applications, antigen retrieval with TE buffer pH 9.0 is suggested, with citrate buffer pH 6.0 as an alternative .
For maximum preservation of PHYH antibody functionality:
Store at -20°C where they remain stable for one year after shipment
The antibodies are typically supplied in PBS buffer containing 0.02% sodium azide and 50% glycerol at pH 7.3
Aliquoting is unnecessary for -20°C storage
Some preparations (20μl sizes) contain 0.1% BSA for added stability
Minimize freeze-thaw cycles to maintain immunoreactivity and specificity
A robust control strategy should include:
Positive controls: Human liver tissue, human kidney tissue, HEK-293 cells, or Jurkat cells (documented positive WB results)
Negative controls: Consider tissues from PHYH knockout models or cell lines with PHYH knockdown
Technical controls: Primary antibody omission (background assessment) and isotype controls (Rabbit IgG, for non-specific binding evaluation)
Antigen retrieval controls: For IHC, compare results with and without recommended retrieval methods (TE buffer pH 9.0 or citrate buffer pH 6.0)
Comprehensive validation requires multiple strategies:
Western blot verification: Confirm detection of bands at expected molecular weights (36 kDa and 70 kDa for PHYH)
Multiple antibody comparison: Test different antibodies targeting distinct PHYH epitopes
Genetic controls: Utilize PHYH knockdown or knockout models as critical negative controls
Proteomic confirmation: Perform immunoprecipitation followed by mass spectrometry
Expression pattern correlation: Cross-reference with established PHYH expression patterns in known positive tissues (human liver, kidney)
Publication of detailed validation methodology strengthens the reliability of research findings and facilitates reproducibility.
Analysis of TCGA data has revealed significant correlations between PHYH expression and clinical outcomes in clear cell renal cell carcinoma (ccRCC):
| Clinical Parameter | Finding | Statistical Significance |
|---|---|---|
| Tumor vs. Normal Tissue | Lower expression in tumor | p = 1.156e−19 |
| Survival Analysis | High expression = better prognosis | p = 9e−05 |
| Tumor Grade | Lower expression in high-grade tumors (G3-4) | p = 0.025 |
| Disease Stage | Lower expression in advanced stage (III & IV) | p = 5.604e−05 |
| Tumor Size | Lower expression in larger tumors (T3-4) | p = 4.373e−05 |
Both univariate and multivariate Cox regression analyses confirmed PHYH as an independent prognostic factor (p < 0.05). These findings were independently validated using the ICGC database, showing consistent results for expression levels (p = 5.214e−18) and survival benefit (p = 1.51e−03) .
For robust investigation of PHYH in cancer, particularly renal cancer, a multi-faceted approach is recommended:
Protein expression analysis:
Transcriptomic analysis:
Functional studies:
Gene silencing or overexpression in relevant cell lines
Phenotypic assays (proliferation, migration, invasion)
Pathway analysis:
Integration of these methodologies with clinical data provides comprehensive insights into PHYH's role in cancer progression and patient outcomes.
When investigating disease models with PHYH antibodies, researchers should address several critical factors:
For peroxisomal disorders (Refsum disease, Zellweger syndrome):
For cancer research (particularly renal cell carcinoma):
For metabolic pathway studies:
Technical considerations:
Optimize fixation protocols for disease-specific tissue characteristics
Adjust antigen retrieval methods based on disease-related protein modifications
PHYH participates in complex gene networks that can be investigated through multiple approaches:
Identified interactions: Gene-gene interaction analysis reveals PHYH connects with 10 different genes, with particularly strong associations with 5 PEX genes encoding peroxin proteins:
Investigation methods:
Co-immunoprecipitation with PHYH antibodies followed by mass spectrometry
Proximity ligation assays for visualizing protein interactions in situ
Correlative expression analysis using The Human Protein Atlas, TCGA, and ICGC databases
Network visualization using interactive gene view software (recommended confidence threshold ≥0.7)
Immunity associations: Preliminary data suggests connections between PHYH and:
This network analysis provides insights into PHYH's broader functional context beyond its enzymatic role in alpha-oxidation.
When encountering problems with PHYH antibody performance in Western blot, implement this systematic troubleshooting approach:
No bands or unexpected molecular weights:
Signal optimization:
Background reduction:
Increase blocking time or agent concentration
Implement more stringent washing protocols
Test alternative blocking agents
Validation strategies:
Optimizing IHC protocols for PHYH antibodies requires careful attention to several parameters:
Antigen retrieval optimization:
Dilution optimization:
Control implementation:
Protocol considerations:
Result analysis:
PHYH antibodies serve as crucial tools in investigating peroxisomal disorders through multiple applications:
Diagnostic applications:
Mechanistic studies:
Genotype-phenotype correlations:
Therapeutic development support:
Monitoring PHYH expression or localization in response to experimental treatments
Validation of gene therapy or protein replacement approaches
Gene Set Enrichment Analysis (GSEA) has identified several pathways differentially enriched based on PHYH expression levels in clear cell renal cell carcinoma:
These pathway associations suggest that PHYH influences multiple metabolic processes relevant to cancer development and progression, extending beyond its canonical role in phytanic acid metabolism.
Researchers can implement several strategies to effectively integrate PHYH expression data with clinical parameters:
Statistical integration approaches:
Survival analysis methodologies:
Clinical correlation analysis:
Nomogram development:
Multi-omics integration:
Correlation of protein-level data (from antibody-based methods) with transcriptomic analyses
Integration with genomic alterations and epigenetic modifications
To ensure robust verification of PHYH expression across experimental platforms, researchers should implement a multi-modal validation strategy:
Cross-platform verification:
Multi-database validation:
Methodological triangulation:
Combine antibody-based detection methods with:
Mass spectrometry-based proteomics
Transcriptomic analysis
Functional assays measuring PHYH enzyme activity
Integration of clinical samples:
Compare findings from cell lines with patient-derived tissues
Assess protein localization and expression levels across diverse sample types
This comprehensive approach ensures that observations about PHYH expression are robust across different detection methods and experimental systems.
The expanding understanding of PHYH biology suggests several promising research directions:
Cancer biomarker development: Further validation of PHYH as a prognostic marker in renal cancer and investigation of its potential in other cancer types .
Therapeutic target exploration: Investigation of PHYH modulation as a potential therapeutic strategy, particularly in cancers where its expression correlates with outcomes.
Metabolic pathway interactions: Deeper characterization of PHYH's role in the metabolic pathways identified through GSEA, including butanoate metabolism and PPAR signaling .
Peroxisome-immune system interactions: Further exploration of the connections between PHYH, peroxisomal function, and immune responses in both cancer and inflammatory conditions .
Advanced antibody applications: Development of phospho-specific or conformation-specific PHYH antibodies to investigate post-translational modifications and structural changes in disease states.
PHYH antibodies will continue to be essential tools in advancing our understanding of this enzyme's diverse biological roles and therapeutic potential across multiple disease contexts.