PHYH Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to PHYH Antibody

PHYH antibodies are immunological reagents designed to specifically detect and bind to phytanoyl-CoA 2-hydroxylase (PHYH), a peroxisomal enzyme involved in the alpha-oxidation of 3-methyl branched fatty acids. These antibodies serve as essential tools for studying PHYH expression, localization, and function across various experimental platforms including Western blotting, immunohistochemistry, and immunofluorescence. PHYH antibodies are available in both polyclonal and monoclonal formats, each with specific advantages for different research applications. The antibodies are typically raised in rabbit or mouse hosts against specific immunogens derived from human PHYH protein sequences .

PHYH antibodies have gained particular importance due to the enzyme's role in several metabolic disorders. The target protein, phytanoyl-CoA 2-hydroxylase, catalyzes the conversion of phytanoyl-CoA to 2-hydroxyphytanoyl-CoA, which represents the first step in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. This critical metabolic function has implications for several human diseases, making PHYH antibodies valuable research tools in pathophysiological studies .

Biological Function

PHYH plays a crucial role in lipid metabolism within peroxisomes. The enzyme specifically catalyzes the hydroxylation of not only racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA but also a variety of other mono-branched 3-methylacyl-CoA esters with a chain length of at least seven carbon atoms. Additionally, it can hydroxylate straight-chain acyl-CoA esters with a chain length exceeding four carbon atoms . This alpha-oxidation pathway is essential for processing branched-chain fatty acids like phytanic acid, which cannot undergo direct beta-oxidation due to their methyl branch at the beta position .

Clinical Relevance

Mutations in the PHYH gene are associated with Refsum disease, a rare autosomal recessive disorder characterized by the accumulation of phytanic acid in plasma and tissues. Additionally, deficient PHYH protein activity has been linked to Zellweger syndrome and rhizomelic chondrodysplasia punctata, both serious peroxisomal disorders . Recent research has also identified altered PHYH expression in certain cancers, particularly clear cell renal cell carcinoma (ccRCC), suggesting a potential role in cancer biology .

Types and Formats

PHYH antibodies are available as both polyclonal and monoclonal reagents. Polyclonal antibodies are more commonly available from commercial sources and typically derived from rabbit hosts, while monoclonal antibodies are primarily mouse-derived . Most commercial PHYH antibodies are provided in unconjugated format, though some are available in glycerol-containing formulations for enhanced stability .

Immunogen Information

Most PHYH antibodies are developed against specific immunogenic regions of the protein. For example, some antibodies target the amino acid sequence "LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRA" within the human PHYH protein . The selection of highly antigenic and conserved regions contributes to the specificity and cross-reactivity profiles of these antibodies.

Western Blot Analysis

Western blot represents one of the most common applications for PHYH antibodies. These antibodies typically detect bands at approximately 36 kDa, corresponding to the monomeric form of PHYH, and sometimes at 70 kDa, which may represent the dimeric form of the protein . Recommended dilutions for Western blot applications range from 1:100 to 1:1000, or 0.04-0.4 μg/mL, depending on the specific antibody and experimental conditions .

Immunohistochemistry

PHYH antibodies are frequently used for immunohistochemical analysis of both frozen and paraffin-embedded tissues. For paraffin sections, heat-induced epitope retrieval (HIER) at pH 6 is typically recommended . Immunohistochemistry with PHYH antibodies has revealed cytoplasmic localization in various cell types, consistent with the peroxisomal localization of the protein. Recommended dilutions for immunohistochemistry applications generally range from 1:50 to 1:200 .

Other Applications

In addition to Western blot and immunohistochemistry, PHYH antibodies are validated for various other applications:

ApplicationRecommended Dilution Range
Western Blot1:100-1:1000 (or 0.04-0.4 μg/mL)
Immunohistochemistry1:50-1:200
ELISA1:500-1:3000
Immunofluorescence1:50-1:500

PHYH in Cancer Research

Recent research has identified significant associations between PHYH expression and cancer progression, particularly in clear cell renal cell carcinoma (ccRCC). A study using The Cancer Genome Atlas (TCGA) data revealed that PHYH expression is significantly lower in ccRCC compared to normal kidney tissues (p = 1.156e−19) . Furthermore, Kaplan-Meier survival analysis demonstrated that high expression of PHYH correlates with better prognosis compared to low expression (p = 9e−05) . These findings suggest potential prognostic value for PHYH expression analysis in ccRCC.

Clinical Correlations in ccRCC

The relationship between PHYH expression and various clinical parameters in ccRCC has been investigated, revealing several significant associations:

Clinical CharacteristicRelationship with PHYH Expressionp-value
Gender (Female vs. Male)OR: 0.5940.005
Grade (G3-4 vs. G1-2)OR: 0.5910.003
Stage (Stage I&II vs. Stage III&IV)OR: 0.506<0.001
T (T1-2 vs. T3-4)OR: 0.5290.001

These correlations indicate that decreased PHYH expression is associated with more advanced disease characteristics in ccRCC, supporting its potential role as a prognostic biomarker .

Pathway Analysis

Gene Set Enrichment Analysis (GSEA) of PHYH expression in ccRCC has identified several metabolic pathways associated with PHYH expression levels, including butanoate metabolism, histidine metabolism, propanoate metabolism, pyruvate metabolism, tryptophan metabolism, PPAR signaling pathway, and the renin-angiotensin system . These findings suggest a broader role for PHYH in cellular metabolism beyond its established function in phytanic acid metabolism.

Gene-Gene Interactions

Investigation of gene-gene interactions has revealed associations between PHYH and several peroxin (PEX) genes, including PEX2, PEX7, PEX10, PEX13, and PEX14 . This interaction network underscores the functional integration of PHYH within the broader peroxisomal protein network and suggests potential cooperative roles in peroxisomal function and metabolic regulation.

Future Perspectives and Emerging Applications

The continued development and characterization of PHYH antibodies will likely facilitate further research into the role of this enzyme in both normal physiology and disease states. Emerging applications for PHYH antibodies include their use in multiplex immunoassays, single-cell protein analyses, and potentially as tools for developing diagnostic or prognostic tests for Refsum disease and certain cancers.

The association between PHYH expression and cancer prognosis, particularly in ccRCC, suggests potential clinical applications for PHYH antibodies in cancer biomarker research. Further investigation may reveal additional cancer types where PHYH expression has prognostic or predictive value, expanding the utility of these antibodies in oncology research and potentially clinical diagnostics.

Additionally, with the growing interest in peroxisomal disorders and lipid metabolism in various diseases, PHYH antibodies will continue to serve as essential tools for investigating the pathophysiological mechanisms underlying these conditions. The development of more specific, sensitive, and versatile PHYH antibodies will further enhance their utility in both basic research and clinical applications.

Product Specs

Buffer
Phosphate-buffered saline (PBS) with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
Typically, we can ship the products within 1-3 business days after receiving your orders. Delivery times may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Synonyms
LN1 antibody; LNAP1 antibody; LNAP1, mouse, homolog of antibody; OTTHUMP00000019131 antibody; OTTHUMP00000019132 antibody; OTTHUMP00000179083 antibody; OTTHUMP00000216226 antibody; PAHX antibody; PAHX_HUMAN antibody; peroxisomal antibody; PhyH antibody; PHYH1 antibody; Phytanic acid oxidase antibody; phytanoil-CoA alpha hydroxylase antibody; phytanoyl CoA 2 hydroxylase antibody; Phytanoyl CoA 2 oxoglutarate dioxygenase antibody; Phytanoyl CoA alpha hydroxylase antibody; Phytanoyl CoA dioxygenase antibody; Phytanoyl CoA dioxygenase peroxisomal antibody; Phytanoyl-CoA alpha-hydroxylase antibody; Phytanoyl-CoA dioxygenase antibody; RD antibody
Target Names
PHYH
Uniprot No.

Target Background

Function
PHYH Antibody catalyzes the 2-hydroxylation of not only racemic phytanoyl-CoA and the isomers of 3-methylhexadecanoyl-CoA but also a variety of other mono-branched 3-methylacyl-CoA esters (with a chain length of at least seven carbon atoms) and straight-chain acyl-CoA esters (with a chain length longer than four carbon atoms). It does not hydroxylate long and very long straight-chain acyl-CoAs or 2-methyl- and 4-methyl-branched acyl-CoAs.
Gene References Into Functions
  1. Three heterozygous variants: c.85C>T (p.Pro29Ser), c.135-2A>G, and c.768del63bp (p.Phe257Glnfs*16) were identified in a family with Refsum's disease. PMID: 28681609
  2. The substrate specificity of PAHX is broader than previously assumed. Therefore, Refsum disease may be characterized by an accumulation of not only phytanic acid but also other 3-alkyl-branched fatty acids. PMID: 12923223
  3. Ten novel PHYH mutations were identified in Refsum disease patients. PMID: 14974078
  4. Research has shown that both unprocessed and processed forms are capable of hydroxylating a range of CoA derivatives. Site-directed mutagenesis was employed to support proposals regarding the identity of the iron binding sites of PAHX. PMID: 15930519
  5. The mechanism by which phytanoyl-CoA 2-hydroxylase (PAHX) binds to iron(II) and 2-oxoglutarate at its active site distinguishes it from other human 2-oxoglutarate (2OG)-dependent oxygenases. PMID: 16186124
  6. In the absence of elevated phytanic acid concentrations, clinical neurological abnormalities in heterozygous relatives of Refsum patients are not attributable to heterozygosity for PAHX mutations. PMID: 18612766
Database Links

HGNC: 8940

OMIM: 266500

KEGG: hsa:5264

STRING: 9606.ENSP00000263038

UniGene: Hs.498732

Involvement In Disease
Refsum disease (RD)
Protein Families
PhyH family
Subcellular Location
Peroxisome.
Tissue Specificity
Expressed in liver, kidney, and T-cells, but not in spleen, brain, heart, lung and skeletal muscle.

Q&A

What is PHYH and what is its biological function?

PHYH (Phytanoyl-CoA 2-hydroxylase), also known as Phytanic acid oxidase or Phytanoyl-CoA alpha-hydroxylase, is a peroxisomal enzyme that plays a crucial role in lipid metabolism. It catalyzes the first step in the alpha-oxidation of phytanic acid, converting phytanoyl-CoA to 2-hydroxyphytanoyl-CoA . This enzyme is critical for the metabolism of 3-methyl branched fatty acids in peroxisomes .

Research indicates that PHYH may also participate in determining the number of peroxisomes within cells and is involved in regulating their activities. Mutations in the PHYH gene can lead to serious conditions such as Refsum disease, while deficient protein activity has been associated with Zellweger syndrome and rhizomelic conditions .

What applications can PHYH antibodies be used for in laboratory research?

PHYH antibodies have multiple validated research applications:

ApplicationValidation StatusSamples
Western Blot (WB)Validated (5 publications)Human, mouse, rat
Immunohistochemistry (IHC)Validated (1 publication)Human kidney tissue
ELISAValidatedHuman, mouse, rat

Positive Western Blot detection has been reported in human liver tissue, HEK-293 cells, human kidney tissue, and Jurkat cells . For IHC applications, successful results have been documented in human kidney tissue studies with specific antigen retrieval methods .

What are the recommended dilutions for different applications of PHYH antibodies?

Optimal dilution ranges vary by application:

ApplicationRecommended Dilution RangeNotes
Western Blot (WB)1:500-1:2000Sample-dependent
Immunohistochemistry (IHC)1:20-1:200Requires antigen retrieval

These ranges serve as starting points, and researchers should titrate the antibody in their specific experimental systems to determine optimal conditions. For IHC applications, antigen retrieval with TE buffer pH 9.0 is suggested, with citrate buffer pH 6.0 as an alternative .

How should PHYH antibodies be stored and handled for optimal results?

For maximum preservation of PHYH antibody functionality:

  • Store at -20°C where they remain stable for one year after shipment

  • The antibodies are typically supplied in PBS buffer containing 0.02% sodium azide and 50% glycerol at pH 7.3

  • Aliquoting is unnecessary for -20°C storage

  • Some preparations (20μl sizes) contain 0.1% BSA for added stability

  • Minimize freeze-thaw cycles to maintain immunoreactivity and specificity

What controls should be used when working with PHYH antibodies?

A robust control strategy should include:

  • Positive controls: Human liver tissue, human kidney tissue, HEK-293 cells, or Jurkat cells (documented positive WB results)

  • Negative controls: Consider tissues from PHYH knockout models or cell lines with PHYH knockdown

  • Technical controls: Primary antibody omission (background assessment) and isotype controls (Rabbit IgG, for non-specific binding evaluation)

  • Antigen retrieval controls: For IHC, compare results with and without recommended retrieval methods (TE buffer pH 9.0 or citrate buffer pH 6.0)

How can researchers validate the specificity of PHYH antibodies in their experimental systems?

Comprehensive validation requires multiple strategies:

  • Western blot verification: Confirm detection of bands at expected molecular weights (36 kDa and 70 kDa for PHYH)

  • Multiple antibody comparison: Test different antibodies targeting distinct PHYH epitopes

  • Genetic controls: Utilize PHYH knockdown or knockout models as critical negative controls

  • Proteomic confirmation: Perform immunoprecipitation followed by mass spectrometry

  • Expression pattern correlation: Cross-reference with established PHYH expression patterns in known positive tissues (human liver, kidney)

Publication of detailed validation methodology strengthens the reliability of research findings and facilitates reproducibility.

How does PHYH expression correlate with clinical outcomes in renal cancer research?

Analysis of TCGA data has revealed significant correlations between PHYH expression and clinical outcomes in clear cell renal cell carcinoma (ccRCC):

Clinical ParameterFindingStatistical Significance
Tumor vs. Normal TissueLower expression in tumorp = 1.156e−19
Survival AnalysisHigh expression = better prognosisp = 9e−05
Tumor GradeLower expression in high-grade tumors (G3-4)p = 0.025
Disease StageLower expression in advanced stage (III & IV)p = 5.604e−05
Tumor SizeLower expression in larger tumors (T3-4)p = 4.373e−05

Both univariate and multivariate Cox regression analyses confirmed PHYH as an independent prognostic factor (p < 0.05). These findings were independently validated using the ICGC database, showing consistent results for expression levels (p = 5.214e−18) and survival benefit (p = 1.51e−03) .

What methodologies are recommended for studying PHYH in cancer research?

For robust investigation of PHYH in cancer, particularly renal cancer, a multi-faceted approach is recommended:

  • Protein expression analysis:

    • Immunohistochemistry (IHC): Using validated PHYH antibodies (1:20-1:200) with TE buffer pH 9.0 for antigen retrieval

    • Western blot: Quantitative measurement of protein levels (antibody dilution 1:500-1:2000)

  • Transcriptomic analysis:

    • RNA expression profiling correlated with clinical outcomes (as demonstrated with TCGA data)

  • Functional studies:

    • Gene silencing or overexpression in relevant cell lines

    • Phenotypic assays (proliferation, migration, invasion)

  • Pathway analysis:

    • Gene Set Enrichment Analysis (GSEA) has identified several metabolic pathways associated with PHYH expression in ccRCC, including:

      • Butanoate metabolism

      • Histidine metabolism

      • Propanoate metabolism

      • Pyruvate metabolism

      • Tryptophan metabolism

      • PPAR signaling pathway

      • Renin-angiotensin system

Integration of these methodologies with clinical data provides comprehensive insights into PHYH's role in cancer progression and patient outcomes.

What are the considerations for using PHYH antibodies in studying specific disease models?

When investigating disease models with PHYH antibodies, researchers should address several critical factors:

  • For peroxisomal disorders (Refsum disease, Zellweger syndrome):

    • Select antibodies capable of detecting specific mutant forms relevant to the disease

    • Consider epitope accessibility in mutant proteins

  • For cancer research (particularly renal cell carcinoma):

    • Account for tumor microenvironment effects on antibody performance

    • Select tissues representing different disease stages

    • Consider the demonstrated correlation between decreased PHYH expression and adverse clinicopathological features in ccRCC

  • For metabolic pathway studies:

    • Complement antibody-based methods with gene expression analysis when investigating PHYH's role in pathways like butanoate metabolism or PPAR signaling

  • Technical considerations:

    • Optimize fixation protocols for disease-specific tissue characteristics

    • Adjust antigen retrieval methods based on disease-related protein modifications

What gene networks interact with PHYH and how can this be studied?

PHYH participates in complex gene networks that can be investigated through multiple approaches:

  • Identified interactions: Gene-gene interaction analysis reveals PHYH connects with 10 different genes, with particularly strong associations with 5 PEX genes encoding peroxin proteins:

    • PEX2

    • PEX7

    • PEX10

    • PEX13

    • PEX14

  • Investigation methods:

    • Co-immunoprecipitation with PHYH antibodies followed by mass spectrometry

    • Proximity ligation assays for visualizing protein interactions in situ

    • Correlative expression analysis using The Human Protein Atlas, TCGA, and ICGC databases

    • Network visualization using interactive gene view software (recommended confidence threshold ≥0.7)

  • Immunity associations: Preliminary data suggests connections between PHYH and:

    • Microsatellite instability

    • Immune checkpoint inhibitors

    • Various immunity mechanisms

This network analysis provides insights into PHYH's broader functional context beyond its enzymatic role in alpha-oxidation.

How can researchers troubleshoot issues with PHYH antibody performance in Western blot applications?

When encountering problems with PHYH antibody performance in Western blot, implement this systematic troubleshooting approach:

  • No bands or unexpected molecular weights:

    • Verify loading and transfer efficiency with reversible staining or housekeeping controls

    • Confirm target against expected molecular weights (36 kDa and 70 kDa for PHYH)

    • Test sample preparation modifications for peroxisomal proteins

  • Signal optimization:

    • Test dilutions within the recommended range (1:500-1:2000)

    • Adjust incubation time and temperature

    • For weak signals, employ signal amplification systems or increase exposure time

  • Background reduction:

    • Increase blocking time or agent concentration

    • Implement more stringent washing protocols

    • Test alternative blocking agents

  • Validation strategies:

    • Use known positive control samples (human liver tissue, HEK-293 cells, human kidney tissue, Jurkat cells)

    • Test antibody in alternative applications where previously validated

    • Consider epitope-specific factors that might affect recognition

What are the best practices for optimizing immunohistochemistry protocols with PHYH antibodies?

Optimizing IHC protocols for PHYH antibodies requires careful attention to several parameters:

  • Antigen retrieval optimization:

    • Primary method: TE buffer at pH 9.0

    • Alternative method: Citrate buffer pH 6.0

    • Compare results with both methods to determine optimal retrieval for specific tissues

  • Dilution optimization:

    • Begin with the recommended range (1:20-1:200)

    • Perform a dilution series to identify optimal concentration for specific tissues

  • Control implementation:

    • Positive control: Human kidney tissue (verified for positive IHC results)

    • Negative controls: Primary antibody omission and isotype controls

  • Protocol considerations:

    • Optimize blocking steps to minimize background

    • Adjust fixation protocols based on tissue type

    • Select detection systems compatible with rabbit IgG primary antibodies

  • Result analysis:

    • Reference Human Protein Atlas data on PHYH immunohistochemistry

    • Compare staining patterns between normal and disease tissues

    • Document optimization parameters for reproducibility

How are PHYH antibodies used in studying peroxisomal disorders?

PHYH antibodies serve as crucial tools in investigating peroxisomal disorders through multiple applications:

  • Diagnostic applications:

    • Western blot analysis to quantify PHYH protein levels in patient-derived samples

    • IHC to evaluate PHYH distribution patterns in affected tissues

  • Mechanistic studies:

    • Immunofluorescence to visualize PHYH localization within peroxisomes

    • Co-localization studies with other peroxisomal markers to assess organelle integrity

    • Investigation of PHYH interactions with PEX proteins, which are often disrupted in peroxisomal biogenesis disorders

  • Genotype-phenotype correlations:

    • Analysis of mutant PHYH proteins in Refsum disease

    • Assessment of PHYH levels and localization in Zellweger syndrome

    • Correlation of antibody-detected PHYH levels with metabolic abnormalities

  • Therapeutic development support:

    • Monitoring PHYH expression or localization in response to experimental treatments

    • Validation of gene therapy or protein replacement approaches

What specific pathways are associated with PHYH expression in cancer research?

Gene Set Enrichment Analysis (GSEA) has identified several pathways differentially enriched based on PHYH expression levels in clear cell renal cell carcinoma:

PathwayAssociation with PHYH ExpressionPotential Significance
Butanoate metabolismDifferentially enriched in PHYH phenotypeMetabolic reprogramming in cancer
Histidine metabolismDifferentially enriched in PHYH phenotypeAmino acid metabolism alterations
Propanoate metabolismDifferentially enriched in PHYH phenotypeShort-chain fatty acid processing
Pyruvate metabolismDifferentially enriched in PHYH phenotypeCentral carbon metabolism
Tryptophan metabolismDifferentially enriched in PHYH phenotypeImmunomodulatory potential
PPAR signaling pathwayDifferentially enriched in PHYH phenotypeLipid homeostasis and inflammation
Renin-angiotensin systemDifferentially enriched in PHYH phenotypeVascular regulation

These pathway associations suggest that PHYH influences multiple metabolic processes relevant to cancer development and progression, extending beyond its canonical role in phytanic acid metabolism.

How can researchers integrate PHYH expression data with clinical parameters?

Researchers can implement several strategies to effectively integrate PHYH expression data with clinical parameters:

  • Statistical integration approaches:

    • Multivariate Cox regression analysis as demonstrated in ccRCC studies, which identified PHYH as an independent prognostic factor

    • Logistic regression to assess correlations between PHYH expression and clinicopathologic variables

  • Survival analysis methodologies:

    • Kaplan-Meier survival analysis with log-rank tests to compare outcomes between high and low PHYH expression groups

    • Determination of optimal cut-off values using median expression values or more sophisticated methods

  • Clinical correlation analysis:

    • Assessment of associations between PHYH expression and specific clinical parameters:

      • Tumor grade (G1-2 vs. G3-4)

      • UICC stage (Stage I&II vs. Stage III&IV)

      • Primary tumor size (T1-2 vs. T3-4)

  • Nomogram development:

    • Integration of PHYH expression with clinical pathologic features into prognostic nomograms, as has been done for ccRCC

    • Validation of such models using independent cohorts (e.g., TCGA and ICGC datasets)

  • Multi-omics integration:

    • Correlation of protein-level data (from antibody-based methods) with transcriptomic analyses

    • Integration with genomic alterations and epigenetic modifications

What methods can verify PHYH expression across different experimental platforms?

To ensure robust verification of PHYH expression across experimental platforms, researchers should implement a multi-modal validation strategy:

  • Cross-platform verification:

    • Compare protein detection by Western blot (using 1:500-1:2000 dilution) with mRNA expression data

    • Correlate IHC findings (using 1:20-1:200 dilution) with RNA-seq or qPCR results

    • Validate findings across different antibodies targeting distinct PHYH epitopes

  • Multi-database validation:

    • Verify expression patterns across complementary databases:

      • TCGA (The Cancer Genome Atlas)

      • ICGC (International Cancer Genome Consortium)

      • GTEx (Genotype-Tissue Expression)

      • HPA (Human Protein Atlas)

  • Methodological triangulation:

    • Combine antibody-based detection methods with:

      • Mass spectrometry-based proteomics

      • Transcriptomic analysis

      • Functional assays measuring PHYH enzyme activity

  • Integration of clinical samples:

    • Compare findings from cell lines with patient-derived tissues

    • Assess protein localization and expression levels across diverse sample types

This comprehensive approach ensures that observations about PHYH expression are robust across different detection methods and experimental systems.

What are the future research directions for PHYH antibody applications?

The expanding understanding of PHYH biology suggests several promising research directions:

  • Cancer biomarker development: Further validation of PHYH as a prognostic marker in renal cancer and investigation of its potential in other cancer types .

  • Therapeutic target exploration: Investigation of PHYH modulation as a potential therapeutic strategy, particularly in cancers where its expression correlates with outcomes.

  • Metabolic pathway interactions: Deeper characterization of PHYH's role in the metabolic pathways identified through GSEA, including butanoate metabolism and PPAR signaling .

  • Peroxisome-immune system interactions: Further exploration of the connections between PHYH, peroxisomal function, and immune responses in both cancer and inflammatory conditions .

  • Advanced antibody applications: Development of phospho-specific or conformation-specific PHYH antibodies to investigate post-translational modifications and structural changes in disease states.

PHYH antibodies will continue to be essential tools in advancing our understanding of this enzyme's diverse biological roles and therapeutic potential across multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.