plac8.1 Antibody, Biotin conjugated

Mechanism and Function of PLAC8

PLAC8 is a 12 kDa cysteine-rich protein localized to lysosomes and implicated in autophagy regulation. Studies demonstrate its role in facilitating lysosome-autophagosome fusion, a critical step in autophagic degradation pathways ( ). Knockdown of PLAC8 reduces co-localization of autophagy markers (LC3 and Lamp2) and accumulates autophagy substrates (p62 and LC3-II), indicating impaired autophagy ( ).

Applications of Biotin-Conjugated PLAC8 Antibodies

Biotin-conjugated PLAC8 antibodies are optimized for assays requiring high sensitivity and specificity, such as:

Aviva Systems Biology ARP47959_P050-Biotin

• Immunogen: Synthetic peptide corresponding to PLAC8 (AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC) ( ).

• Reactivity: Human and cow (93% homology) ( ).

• Purification: Affinity-purified rabbit polyclonal antibody ( ).

• Storage: 4°C (light-protected) for 12 months; -20°C (with glycerol) for extended storage ( ).

Cusabio CSB-PA873705LD01HU

• Conjugation: Biotin ( ).

• Applications: ELISA and IHC with dilutions of 1:20–1:200 ( ).

• Pricing: $166 per vial ( ).

Research Findings

• Autophagy Regulation: PLAC8 knockdown reduces lysosome-autophagosome fusion by 80%, impairing autophagic flux ( ). Overexpression rescues fusion, confirming its regulatory role ( ).

• Cancer Implications: PLAC8 is upregulated in pancreatic cancer cells (e.g., CAPAN-2) and promotes tumor formation via autophagy modulation ( ).

• ELISA Validation: FineTest’s ELISA kit demonstrates 97% recovery in serum samples and 94% inter-assay precision ( ).

Comparison of Biotin-Conjugated PLAC8 Antibodies