plpp7 Antibody

Shipped with Ice Packs
In Stock

Description

PLPP7 Antibody Applications and Validation

PLPP7 antibodies are widely used in techniques such as:

  • Western blot (WB)

  • Immunofluorescence (IF)

  • Immunohistochemistry (IHC)

  • Immunoprecipitation (IP)

Muscle Differentiation and Disease:

  • PLPP7 acts as a negative regulator of myoblast differentiation by modulating mTOR signaling .

  • In DM1, PLPP7 expression correlates with dorsiflexion strength (r = 0.87), and its downregulation disrupts nuclear integrity and chromatin organization .

  • Western blot analyses using Proteintech’s 20635-1-AP antibody confirmed PLPP7 protein reduction in DM1 patient biopsies .

Genome Organization:

  • PLPP7 interacts with muscle-specific genes, and its depletion alters pathways related to cell communication, stress response, and metabolism .

  • Co-regulated genes with TMEM38A (another nuclear envelope protein) show overlap in DM1 transcriptomes, suggesting synergistic roles in muscle pathology .

Table: Key Studies Utilizing PLPP7 Antibodies

Study FocusAntibody UsedKey FindingsSource
DM1 Muscle BiopsiesProteintech 20635-1-APPLPP7 protein levels reduced in DM1, correlating with disease severity
Nuclear IntegritySigma-Aldrich HPA070252PLPP7 knockdown disrupts chromatin organization in myoblasts
Genome-Wide CRISPR ScreensN/APARKIN regulators identified, but PLPP7 not directly linked to mitophagy

Disease Relevance:

  • Mutations in PLPP7 are linked to Emery-Dreifuss muscular dystrophy (EDMD)-like phenotypes, highlighting its role in muscle disease .

  • PLPP7 and TMEM38A jointly regulate ~10% of differentially expressed genes in DM1, underscoring their functional overlap .

Technical Considerations

  • Immunogen: Common immunogens include the peptide sequence GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK .

  • Storage: Antibodies are typically stored at -20°C in glycerol-containing buffers .

  • Controls: Prestige Antibodies® include antigen controls for specificity verification .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
plpp7; ppapdc3; zgc:77336; Inactive phospholipid phosphatase 7; Phosphatidic acid phosphatase type 2 domain-containing protein 3
Target Names
plpp7
Uniprot No.

Target Background

Function
PLPP7 acts as a negative regulator of myoblast differentiation, partially through its influence on MTOR signaling. It exhibits no detectable enzymatic activity.
Database Links

KEGG: dre:402958

UniGene: Dr.160149

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Nucleus envelope. Endoplasmic reticulum membrane. Membrane; Multi-pass membrane protein.

Q&A

What is PLPP7 and what are its alternative designations in scientific literature?

PLPP7 (Phospholipid Phosphatase 7) is a nuclear envelope transmembrane protein (NET) involved in genome organization and nuclear-cytoskeletal coupling. In scientific literature, PLPP7 may be referenced using various designations:

Alternative NameFull Name
PPAPDC3Phosphatidic Acid Phosphatase Type 2 Domain Containing 3
NET39Nuclear Envelope Transmembrane protein 39
C9orf67Chromosome 9 Open Reading Frame 67
FLJ14662FLJ14662 (older reference name)
MGC12921MGC12921 (older reference name)

PLPP7 is a member of the PAP2 superfamily of phosphatases and haloperoxidases, initially discovered in an in silico screen for secreted or membrane proteins .

What are the typical applications for PLPP7 antibodies in research?

PLPP7 antibodies are versatile research tools that can be employed in multiple experimental approaches:

ApplicationDescriptionValidated By
Western Blot (WB)Detection of PLPP7 protein expression levels and molecular weight confirmationMultiple providers
ELISAQuantitative assessment of PLPP7 protein levelsMultiple providers
Immunofluorescence (IF)Subcellular localization of PLPP7, particularly at the nuclear envelopeMultiple providers
Immunohistochemistry (IHC)Detection of PLPP7 in tissue sectionsMultiple providers
Immunoprecipitation (IP)Isolation of PLPP7 protein complexesProteintech Group (20635-1-AP)

When designing experiments, researchers should consider that PLPP7 is primarily localized to the nuclear envelope as confirmed by subcellular localization studies .

Why does PLPP7 show discrepancy between calculated and observed molecular weights?

A noteworthy methodological consideration is the significant discrepancy between PLPP7's calculated and observed molecular weights:

  • Calculated molecular weight: 29.4 kDa

  • Observed molecular weight on Western blots: approximately 68 kDa

This discrepancy likely results from post-translational modifications, protein-protein interactions that resist denaturation, or the structural properties of this transmembrane protein. When validating PLPP7 antibodies via Western blot, researchers should expect to observe bands at approximately 68 kDa rather than at the calculated weight, and should use appropriate positive controls to confirm specificity.

How is PLPP7 expression altered in myotonic dystrophy type 1, and what methodologies best detect these changes?

PLPP7 expression shows significant alterations in myotonic dystrophy type 1 (DM1), a multisystemic disorder affecting primarily muscle and neurological tissues. Research has demonstrated:

  • PLPP7 gene expression positively correlates with dorsiflexion strength in DM1 patients

  • The main isoform (271 aa) is downregulated in DM1 muscle biopsies

  • This downregulation has been confirmed at the protein level by Western blot in unrelated DM1 muscle biopsies

For reliable quantification of these expression changes, researchers should:

  • Use Western blotting with normalization to housekeeping proteins (e.g., GAPDH)

  • Employ the Licor FC imaging system and ImageStudio Software for quantification

  • Perform at least three biological replicates to confirm results

  • Consider correlation analyses between protein levels and clinical parameters (e.g., muscle strength)

What is the role of PLPP7 in genome organization, and how can researchers study PLPP7-regulated genes?

PLPP7 functions as a muscle-specific NET involved in genome organization. Research methodologies to study its impact on gene regulation include:

  • RNA-sequencing analysis of tissues/cells with altered PLPP7 expression

  • Comparison of differentially expressed genes with known PLPP7-regulated genes

In DM1 muscle biopsies, genes regulated by PLPP7 (and TMEM38A) represent:

  • 13% of differentially expressed genes in proto-DM1

  • 11% of differentially expressed genes in DM1

  • 10% of differentially expressed genes in severe DM1

Pathway analysis of these PLPP7-regulated genes reveals enrichment in:

Enriched Pathways
Signaling
Cell communication
Cell migration
Localization
Response to stress
Metabolic processes

These findings indicate PLPP7's significant role in maintaining normal muscle gene expression patterns.

What experimental considerations are important when distinguishing between PLPP7 isoforms?

When investigating specific PLPP7 isoforms:

  • The main isoform is 271 amino acids in length and shows the most significant downregulation in muscle disorders

  • Researchers should select antibodies that can distinguish between isoforms if studying isoform-specific effects

  • RNA-sequencing analysis can provide isoform-level expression data

  • For protein level analysis, use Western blotting with high-resolution gels (10-15% TGX gels) capable of separating similar-sized isoforms

How can researchers effectively validate PLPP7 antibody specificity?

Thorough validation of PLPP7 antibodies is essential for reliable results:

  • Multiple application testing: Validate the antibody in multiple applications (WB, IF, IHC) to ensure consistent results across platforms

  • Cross-reactivity assessment: Test the antibody against related proteins, particularly other phospholipid phosphatases

  • Knockdown/knockout controls: Use PLPP7-depleted samples as negative controls

  • Peptide competition assays: Pre-incubate the antibody with immunizing peptide to confirm specificity

  • Multiple antibody comparison: Use antibodies from different sources targeting different epitopes

Several commercial antibodies have undergone validation in multiple applications and species, with the most extensively validated including Proteintech Group (20635-1-AP) with 3 references and validation in WB, ELISA, and IP applications .

What is the relationship between PLPP7 and other nuclear envelope proteins in muscle pathology?

The relationship between PLPP7 and other nuclear envelope proteins offers important insights into muscle pathology:

  • PLPP7 functions alongside other NETs like TMEM38A, TOR1AIP1 (LAP1), and EMD (emerin) in genome organization

  • Many NETs misregulated in myotonic dystrophy are also mutated in Emery-Dreifuss muscular dystrophy, suggesting molecular similarities between different muscular dystrophies

  • PLPP7 has been linked to the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex via SAMP1, suggesting a role in nuclear-cytoskeletal coupling

Methodological approaches to study these relationships include:

  • Co-immunoprecipitation using PLPP7 antibodies to identify protein interaction partners

  • Proximity ligation assays to confirm in situ protein-protein interactions

  • Genome organization studies using techniques like Hi-C or ChIP-seq

How can single-cell approaches advance our understanding of PLPP7 function in heterogeneous tissues?

Advanced single-cell technologies offer new opportunities to understand PLPP7 function in complex tissues:

  • Single-cell RNA sequencing can reveal cell-type-specific expression patterns of PLPP7

  • Combining single-cell transcriptomics with PLPP7 antibody-based immunofluorescence can map protein expression at cellular resolution

  • Techniques like CellTag (a lentiviral, combinatorial cell barcoding technology) can enable clonal tracing in heterogeneous samples

  • Integrated multi-omics approaches that combine transcriptomics with proteomics can provide a comprehensive view of PLPP7's role in different cell populations

Research indicates that clonal dynamics and lineage tracing approaches are particularly valuable for understanding cellular heterogeneity in complex diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.