POLE2 Antibody

Introduction to POLE2 Antibody

POLE2 antibodies are immunological reagents designed to detect and quantify the POLE2 protein, a catalytic subunit of DNA polymerase epsilon essential for chromosomal DNA replication and cell cycle progression . These antibodies are widely used in techniques such as Western blot (WB), immunohistochemistry (IHC), and enzyme-linked immunosorbent assay (ELISA) .

Validation and Specificity

POLE2 antibodies undergo rigorous validation to ensure reliability:

For example, monoclonal antibody WH0005427M1 (Sigma-Aldrich) targets the immunogen sequence MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYN and shows specificity for unmodified POLE2 in WB and ELISA .

Cancer Studies

POLE2 antibodies have been instrumental in identifying POLE2's oncogenic roles:

• Glioblastoma: High POLE2 expression correlates with tumor grade and recurrence, validated via IHC in 165 clinical samples .

• Osteosarcoma: Knockdown studies using POLE2 antibodies revealed reduced CD44 stability and Rac signaling pathway inhibition .

• Lung Adenocarcinoma: POLE2 knockdown suppressed proliferation and induced apoptosis in A549 and NCI-H1299 cells, confirmed by WB and qPCR .

Mechanistic Insights

• Ubiquitination Regulation: POLE2 stabilizes FOXM1 in glioblastoma by inhibiting AURKA-mediated ubiquitination .

• Pathway Modulation: In renal cell carcinoma, POLE2 knockdown downregulated p-Akt, CCND1, and survivin, implicating PI3K/Akt pathway involvement .

Clinical Significance

POLE2 overexpression is linked to poor prognosis in multiple cancers:

Future Directions

• Therapeutic Targeting: POLE2’s role in stabilizing oncoproteins like FOXM1 and CD44 positions it as a potential therapeutic target .

• Biomarker Development: Standardized IHC scoring systems (e.g., combined intensity and percentage scores) could improve clinical stratification .