[KO Validated] MAP2K1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

[KO Validated] MAP2K1 Polyclonal Antibody

Product Name [KO Validated] MAP2K1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC
Product Background The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP2K1 (NP_002746.1).
Sequence MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
Recommended Dilution WB
Calculated MW 40kDa/43kDa
Observed MW 45kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Jurkat,HeLa,A-431,MCF-7,Mouse Liver,Mouse Kidney,Rat Thymus
Cellular Location Cytoplasm,Membrane,Nucleus,Peripheral membrane protein,centrosome,cytoskeleton,microtubule organizing center,spindle pole body
Purification Method Affinity purification