[KO Validated] GIT1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

[KO Validated] GIT1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-227508

Product Name [KO Validated] GIT1 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 19kDa/84kDa/85kDa
Cellular Location Cytoplasm
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-640 of human GIT1 (NP_054749.2).
Isotype IgG
Observed Mw 100kDa
Positive Samples U-251MG,A-549,A375,Mouse heart,Rat testis
Purification Method Affinity purification
Recommended Dilution WB
Sequence EIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Mar 08 2019