[KO Validated] HER2 / ErbB2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

[KO Validated] HER2 / ErbB2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-227512

Product Name [KO Validated] HER2 / ErbB2 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 62kDa/70kDa/97kDa/134kDa/136kDa/137kDa
Cellular Location Cell membrane,Cytoplasm,Nucleus,Nucleus,Single-pass type I membrane protein,perinuclear region
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1160 to the C-terminus of human HER2 / ErbB2 (NP_004439.2).
Isotype IgG
Observed Mw 185kDa
Product Background This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Positive Samples 293T,HepG2,HeLa,Mouse uterus
Purification Method Affinity purification
Recommended Dilution WB
Sequence ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Mar 08 2019