[KO Validated] S100A6 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

[KO Validated] S100A6 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-227517

Product Name [KO Validated] S100A6 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 10kDa
Cellular Location Cell membrane,Cytoplasm,Cytoplasmic side,Nucleus envelope,Peripheral membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (NP_055439.1).
Isotype IgG
Observed Mw 10kDa
Product Background The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.
Positive Samples HepG2,NIH/3T3,HT-29,Mouse lung,Mouse skeletal muscle
Purification Method Affinity purification
Recommended Dilution WB
Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Mar 08 2019