DISC1 Polyclonal Antibody Others
$ $99 In stock
Formulation:
Source:
Usage:
DISC1 Polyclonal Antibody -

DISC1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog Number: BT-227583

Product Name DISC1 Polyclonal Antibody
Application WB;IHC
Application Key Western blotting
Calculated Mw 22kDa/37-38kDa/6-93kDa
Cellular Location Cell junction,Cytoplasm,centrosome,cytoskeleton,microtubule organizing center,postsynaptic cell membrane,postsynaptic density,synapse
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DISC1 (NP_001158009.1).
Isotype IgG
Observed Mw 105kDa
Product Background This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Positive Samples U-251MG,293T,SW620,THP-1,mouse pancreas,mouse heart,rat brain,HL-60,Rat heart
Purification Method Affinity purification
Recommended Dilution WB
Sequence MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPP
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Jul 26 2021