[One Step]TIMM17A Antibody Kit Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

[One Step]TIMM17A Antibody Kit

Product Name [One Step]TIMM17A Antibody Kit
Product Type
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human TIMM17A (NP_006326.1).
Sequence MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ