BAX Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

BAX Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-227762

Product Name BAX Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 4kDa/12kDa/15kDa/18kDa/19kDa/21kDa/24kDa
Cellular Location Cytoplasm,Cytoplasm,Mitochondrion membrane,Single-pass membrane protein
Customer Validation WB (Rat , Human)IHC (unknown)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BAX (NP_620116.1).
Isotype IgG
Observed Mw 21kDa
Product Background The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Positive Samples MCF7,SW620,HepG2,HeLa
Purification Method Affinity purification
Recommended Dilution WB
Reference Product: BAX Polyclonal Antibody
Journal: Chinese Journal of Pharmacology and Toxicology
Application: WB
IF:
Species: Rat
PMID:
Title: Effect of sodium para-aminosalicylic acid on apoptosis of PC12 cells induced by lead-exposure

Product: BAX Polyclonal Antibody
Journal: Journal of Ayurveda and Integrative Medicine
Application: IHC
IF:
Species: unknown
PMID: 28256303
Title: Polyphenol-rich fraction of Parquetina nigrescens mitigates dichlorvos-induced neurotoxicity and apoptosis.

Product: BAX Polyclonal Antibody
Journal: Cell Death & Disease
Application: WB
IF: 5.965
Species: Human
PMID: 29802332
Title: Betulinic acid chemosensitizes breast cancer by triggering ER stress-mediated apoptosis by directly targeting GRP78
Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.