IL1B Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

IL1B Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-227764

Product Name IL1B Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 30kDa
Cellular Location Cytoplasm,Cytoplasmic vesicle,Lysosome,Secreted,autophagosome,cytosol,exosome
Customer Validation WB (Rat)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).
Isotype IgG
Observed Mw 37kDa
Product Background The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Positive Samples THP-1
Purification Method Affinity purification
Recommended Dilution WB
Reference Product: IL1B Polyclonal Antibody
Journal: Pancreatology
Application: WB
IF: 2.76
Species: Rat
PMID: 30115563
Title: Quercetin protects against intestinal barrier disruption and inflammation in acute necrotizing pancreatitis through TLR4/MyD88/p38 MAPK and ERS inhibition.

Product: IL1B Polyclonal Antibody
Journal: Molecular Pain
Application: WB
IF: 3.2
Species: Rat
PMID: 30270727
Title: [EXPRESS] TLR4/NF-κB signaling activation in plantar tissue and dorsal root ganglion involves in the development of postoperative pain
Sequence CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.