CREB1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CREB1 Polyclonal Antibody

Product Name CREB1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC;IF
Product Background This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CREB1 (NP_604391.1).
Sequence MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
Recommended Dilution WB
Calculated MW 25kDa/35kDa/36kDa
Observed MW 43kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples A-431
Cellular Location Nucleus
Purification Method Affinity purification
RRID AB_2758388