KIF1C Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

KIF1C Polyclonal Antibody

Product Name KIF1C Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC
Product Background The protein encoded by this gene is a member of the kinesin-like protein family. The family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. Mutations in this gene are a cause of spastic ataxia 2, autosomal recessive.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2).
Sequence EEGGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGG
Recommended Dilution WB
Calculated MW 122kDa
Observed MW 165kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples HeLa,HepG2,293T,K-562,Mouse brain
Cellular Location Cytoplasm,cytoskeleton
Purification Method Affinity purification
RRID AB_2763206