SELL Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SELL Polyclonal Antibody

Product Name SELL Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC;IF
Product Background This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SELL (NP_000646.2).
Sequence MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYY
Recommended Dilution WB
Calculated MW 42kDa/43kDa
Observed MW 74kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Jurkat,Raji,Mouse spleen,Mouse thymus,Rat thymus
Cellular Location Membrane,Single-pass type I membrane protein
Purification Method Affinity purification
RRID AB_2763674