CD47 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CD47 Polyclonal Antibody

Product Name CD47 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC;IF
Product Background This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human CD47 (NP_942088.1).
Sequence LLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPN
Recommended Dilution WB
Calculated MW 31kDa/33kDa/35kDa
Observed MW 47kDa/50kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples MCF7,SKOV3,Mouse lung
Cellular Location Cell membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2763874