CLDN5 Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog No: bt-228488
Product Name | CLDN5 Polyclonal Antibody |
---|---|
Application | WB;IHC;IF |
Application Key | Western blotting |
Calculated Mw | 23kDa |
Cellular Location | Cell junction,Cell membrane,Multi-pass membrane protein,tight junction |
Customer Validation | WB (Rat) |
Host Species | Rabbit |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-303 of human CLDN5 (NP_001124333.1). |
Isotype | IgG |
Observed Mw | 27kDa |
Product Background | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Positive Samples | Mouse lung |
Purification Method | Affinity purification |
Recommended Dilution | WB |
Sequence | REFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV |
Species Reactivity | Human, Mouse, Rat |
Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |