CLDN5 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CLDN5 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-228488

Product Name CLDN5 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 23kDa
Cellular Location Cell junction,Cell membrane,Multi-pass membrane protein,tight junction
Customer Validation WB (Rat)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-303 of human CLDN5 (NP_001124333.1).
Isotype IgG
Observed Mw 27kDa
Product Background This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Positive Samples Mouse lung
Purification Method Affinity purification
Recommended Dilution WB
Sequence REFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.