EPCAM Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

EPCAM Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-228490

Product Name EPCAM Polyclonal Antibody
Application WB;IHC
Application Key Western blotting
Calculated Mw 34kDa
Cellular Location Cell junction,Lateral cell membrane,Single-pass type I membrane protein,tight junction
Customer Validation WB (Human) IHC (Human)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human EPCAM (NP_002345.2).
Isotype IgG
Observed Mw 40kDa
Product Background This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Positive Samples NIH/3T3,Mouse testis
Purification Method Affinity purification
Recommended Dilution WB
Sequence VNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFS
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.