TIMP2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TIMP2 Polyclonal Antibody

Product Name TIMP2 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IF
Product Background This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIMP2 (NP_003246.1).
Sequence VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
Customer Validation IF (Human,Mouse)
Recommended Dilution WB
Calculated MW 24kDa
Observed MW 26kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples A-549,293T,Mouse spleen,Mouse lung,Mouse brain,Rat spleen,Rat lung,Rat brain
Cellular Location Secreted
Purification Method Affinity purification
RRID AB_2762984