XBP1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

XBP1 Polyclonal Antibody

Product Name XBP1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IF
Product Background This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human XBP1 (NP_005071.2).
Sequence MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN
Customer Validation WB (Mouse)
Recommended Dilution WB
Calculated MW 28kDa/40kDa
Observed MW 42kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples 293T,NCI-H460,Mouse eye,Rat liver,Rat eye
Cellular Location Cytoplasm,Endoplasmic reticulum membrane,Endoplasmic reticulum,Membrane,Nucleus,Peripheral membrane protein,Single-pass type II membrane protein
Purification Method Affinity purification
RRID AB_2763779