Osteopontin Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

Osteopontin Polyclonal Antibody

Product Name Osteopontin Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Product Background The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human Osteopontin (NP_001035147.1).
Sequence NDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI
Customer Validation WB (Human)
Recommended Dilution WB
Calculated MW 32kDa/33kDa/35kDa
Observed MW 45-47kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples THP-1,Mouse liver,Mouse kidney,Rat kidney
Cellular Location Secreted
Purification Method Affinity purification
RRID AB_2760918