BGLAP Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

BGLAP Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-228695

Product Name BGLAP Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 11kDa
Cellular Location Secreted
Customer Validation WB (mouse)
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BGLAP (NP_954642.1).
Isotype IgG
Observed Mw 11kDa
Product Background This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.
Positive Samples U-251MG,Mouse pancreas
Purification Method Affinity purification
Recommended Dilution WB
Sequence MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.