E2F7 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

E2F7 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-228702

Product Name E2F7 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 80kDa/98kDa/99kDa
Cellular Location Nucleus
Customer Validation WB (Human)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 540-740 of human E2F7 (NP_976328.2).
Isotype IgG
Observed Mw 105kDa
Positive Samples HeLa,SP2/0,Mouse spleen, Rat spleen
Purification Method Affinity purification
Recommended Dilution WB
Sequence LLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPAGLNGFNVLLSGSQTPPTVGPSSGQLPS
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.