CCR2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CCR2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-228757

Product Name CCR2 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 41kDa
Cellular Location Cell membrane,Multi-pass membrane protein
Customer Validation ELISA (Bacteria)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 315-374 of human CCR2 (NP_001116513.2).
Isotype IgG
Observed Mw 50kDa
Product Background This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
Positive Samples THP-1,Mouse heart
Purification Method Affinity purification
Recommended Dilution WB
Sequence LFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.