TOMM34 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TOMM34 Polyclonal Antibody

Product Name TOMM34 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse
isotype IgG
application WB;IHC
Product Background The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human TOMM34 (NP_006800.2).
Sequence MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Customer Validation WB (Human)
Recommended Dilution WB
Calculated MW 34kDa
Observed MW 35kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples 293T,A-431,HeLa,HepG2,BT-474,SW620,Mouse spleen
Cellular Location Cytoplasm,Cytoplasmic side,Mitochondrion outer membrane,Peripheral membrane protein
Purification Method Affinity purification
RRID AB_2765696