TOMM34 Polyclonal Antibody
Product Name | TOMM34 Polyclonal Antibody |
---|---|
Product Type | |
Host Species | Rabbit |
Species Reactivity | Human, Mouse |
isotype | IgG |
application | WB;IHC |
Product Background | The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human TOMM34 (NP_006800.2). |
Sequence | MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH |
Customer Validation | WB (Human) |
Recommended Dilution | WB |
Calculated MW | 34kDa |
Observed MW | 35kDa |
Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application Key | Western blotting |
Positive Samples | 293T,A-431,HeLa,HepG2,BT-474,SW620,Mouse spleen |
Cellular Location | Cytoplasm,Cytoplasmic side,Mitochondrion outer membrane,Peripheral membrane protein |
Purification Method | Affinity purification |
RRID | AB_2765696 |