LPCAT1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

LPCAT1 Polyclonal Antibody

Product Name LPCAT1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 325-534 of human LPCAT1 (NP_079106.3).
Sequence LPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Customer Validation WB (Human)
Recommended Dilution WB
Calculated MW 59kDa
Observed MW 59kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples BT-474,22Rv1,Hela,A-549,Mouse lung
Cellular Location Endoplasmic reticulum membrane,Golgi apparatus membrane,Lipid droplet,Single-pass type II membrane protein
Purification Method Affinity purification
RRID AB_2765973