FABP3 Polyclonal Antibody
Product Name | FABP3 Polyclonal Antibody |
---|---|
Product Type | |
Host Species | Rabbit |
Species Reactivity | Human, Mouse |
isotype | IgG |
application | WB;IHC;IF |
Product Background | The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1). |
Sequence | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
Customer Validation | WB (Human) |
Recommended Dilution | WB |
Calculated MW | 14kDa |
Observed MW | 14kDa |
Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application Key | Western blotting |
Positive Samples | Mouse heart |
Cellular Location | Cytoplasm |
Purification Method | Affinity purification |
RRID | AB_2766124 |