CDX2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CDX2 Polyclonal Antibody

Product Name CDX2 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Product Background This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CDX2 (NP_001256.3).
Sequence MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS
Recommended Dilution WB
Calculated MW 33kDa
Observed MW 34kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples 293T,MCF7,Mouse small intestine,Mouse thymus,Rat small intestine
Cellular Location Nucleus
Purification Method Affinity purification
RRID AB_2757403