CFHR5 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CFHR5 Polyclonal Antibody

Product Name CFHR5 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Product Background This gene is a member of a small complement factor H (CFH) gene cluster on chromosome 1. Each member of this gene family contains multiple short consensus repeats (SCRs) typical of regulators of complement activation. The protein encoded by this gene has nine SCRs with the first two repeats having heparin binding properties, a region within repeats 5-7 having heparin binding and C reactive protein binding properties, and the C-terminal repeats being similar to a complement component 3 b (C3b) binding domain. This protein co-localizes with C3, binds C3b in a dose-dependent manner, and is recruited to tissues damaged by C-reactive protein. Allelic variations in this gene have been associated, but not causally linked, with two different forms of kidney disease: membranoproliferative glomerulonephritis type II (MPGNII) and hemolytic uraemic syndrome (HUS).
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-569 of human CFHR5 (NP_110414.1).
Sequence GPPPSINNGDTTSFPLSVYPPGSTVTYRCQSFYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQCKFPHKAMISSPPFRAICQEGKFEYPICE
Recommended Dilution WB
Calculated MW 64kDa
Observed MW 75kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples HepG2,K-562,Mouse liver,Rat liver
Cellular Location Secreted
Purification Method Affinity purification
RRID AB_2757913