RAB3D Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

RAB3D Polyclonal Antibody

Product Name RAB3D Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human RAB3D (NP_004274.1).
Sequence MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Recommended Dilution WB
Calculated MW 24kDa
Observed MW 26kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples HepG2,U-87MG,MCF7,SKOV3,Mouse lung,Mouse pancreas
Cellular Location Cell membrane,Cytoplasmic side,Lipid-anchor
Purification Method Affinity purification
RRID AB_2757938