REEP5 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

REEP5 Polyclonal Antibody

Product Name REEP5 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4).
Sequence FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
Recommended Dilution WB
Calculated MW 14kDa/21kDa
Observed MW 21kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples U-87MG,LO2,A375,MCF7,Mouse brain,Mouse heart,Mouse pancreas,Rat brain,Rat heart
Cellular Location Membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2757940