SLC44A4 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC44A4 Polyclonal Antibody

Product Name SLC44A4 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse
isotype IgG
Application WB
Product Background The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.
Reference Array
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2).
Sequence LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNAR
Customer Validation WB (Mouse)
Recommended Dilution WB
Calculated MW 32kDa/70kDa/74kDa/79kDa
Observed MW 79kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples HT-29,K-562,Mouse kidney,Mouse lung
Cellular Location Membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2757982