SLC44A4 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC44A4 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-230093

Product Name SLC44A4 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 32kDa/70kDa/74kDa/79kDa
Cellular Location Membrane,Multi-pass membrane protein
Customer Validation WB (Mouse)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2).
Isotype IgG
Observed Mw 79kDa
Product Background The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.
Positive Samples HT-29,K-562,Mouse kidney,Mouse lung
Purification Method Affinity purification
Recommended Dilution WB
Reference Product: SLC44A4 Polyclonal Antibody
Journal: Cell Death and Differentiation
Application: WB
IF: 8
Species: Mouse
PMID: 30341421
Title: Circular RNA circAGO2 drives cancer progression through facilitating HuR-repressed functions of AGO2-miRNA complexes.
Sequence LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNAR
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Mar 08 2019