SLC22A9 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC22A9 Polyclonal Antibody

Product Name SLC22A9 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
Application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-145 of human SLC22A9 (NP_543142.2).
Sequence FTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLT
Recommended Dilution WB
Calculated MW 26kDa/62kDa
Observed MW 75kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples HepG2,Hela,U-87MG,Mouse liver,Mouse kidney
Cellular Location Basolateral cell membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2757981