SLC22A9 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC22A9 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-230094

Product Name SLC22A9 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 26kDa/62kDa
Cellular Location Basolateral cell membrane,Multi-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-145 of human SLC22A9 (NP_543142.2).
Isotype IgG
Observed Mw 75kDa
Positive Samples HepG2,Hela,U-87MG,Mouse liver,Mouse kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence FTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLT
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Last Modified Mar 08 2019