SLC6A15 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC6A15 Polyclonal Antibody

Product Name SLC6A15 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Mouse
isotype IgG
Application WB
Product Background This gene encodes a member of the solute carrier family 6 protein family which transports neutral amino acids. The encoded protein is thought to play a role in neuronal amino acid transport (PMID: 16185194) and may be associated with major depression (PMID: 21521612). Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1).
Sequence LVVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPALHLNSCKIEEELNKAVQGTGLAFIAFTEAM
Recommended Dilution WB
Calculated MW 32kDa/69kDa/81kDa
Observed MW 82kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Mouse kidney
Cellular Location Membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2757984