LMAN1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

LMAN1 Polyclonal Antibody

Product Name LMAN1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
Application WB;IHC
Product Background The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-480 of human LMAN1 (NP_005561.1).
Sequence PGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH
Recommended Dilution WB
Calculated MW 57kDa
Observed MW 55kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples BT-474,LO2,U-251MG
Cellular Location Endoplasmic reticulum membrane,Endoplasmic reticulum-Golgi intermediate compartment membrane,Golgi apparatus membrane,Single-pass membrane protein,Single-pass type I membrane protein
Purification Method Affinity purification
RRID AB_2757987