STX2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

STX2 Polyclonal Antibody

Product Name STX2 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
Application WB;IF
Product Background The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human STX2 (NP_001971.2).
Sequence MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKL
Recommended Dilution WB
Calculated MW 32kDa/33kDa
Observed MW 36kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples K-562,DU145,SKOV3,A-549,Mouse heart,Mouse testis,Rat liver,Rat heart,Rat testis
Cellular Location Membrane,Single-pass type IV membrane protein
Purification Method Affinity purification
RRID AB_2757991