CYC1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CYC1 Polyclonal Antibody

Product Name CYC1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
Application WB;IHC
Product Background This gene encodes a subunit of the cytochrome bc1 complex, which plays an important role in the mitochondrial respiratory chain by transferring electrons from the Rieske iron-sulfur protein to cytochrome c. Mutations in this gene may cause mitochondrial complex III deficiency, nuclear type 6.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 85-291 of human CYC1 (NP_001907.2).
Sequence SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLK
Recommended Dilution WB
Calculated MW 35kDa
Observed MW 35kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples A-549,A375,LO2,22Rv1,Mouse brain,Mouse kidney,Mouse liver,Mouse heart,Rat liver
Cellular Location Intermembrane side,Mitochondrion inner membrane,Single-pass membrane protein
Purification Method Affinity purification
RRID AB_2757996