EXOSC2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

EXOSC2 Polyclonal Antibody

Product Name EXOSC2 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
Application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-293 of human EXOSC2 (NP_055100.2).
Sequence MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Recommended Dilution WB
Calculated MW 29kDa/30kDa/32kDa
Observed MW 33kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples A-549,HeLa,Mouse liver,Mouse spleen,Rat liver
Cellular Location Cytoplasm,Nucleus,nucleolus
Purification Method Affinity purification
RRID AB_2757998