EXOSC2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

EXOSC2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-230109

Product Name EXOSC2 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 29kDa/30kDa/32kDa
Cellular Location Cytoplasm,Nucleus,nucleolus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-293 of human EXOSC2 (NP_055100.2).
Isotype IgG
Observed Mw 33kDa
Positive Samples A-549,HeLa,Mouse liver,Mouse spleen,Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.