FCRL3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

FCRL3 Polyclonal Antibody

Product Name FCRL3 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
Application WB;IHC
Product Background This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-720 of human FCRL3 (NP_443171.2).
Sequence RRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
Recommended Dilution WB
Calculated MW 21kDa/22kDa/69kDa/77kDa/80kDa/81kDa
Observed MW 105kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Raji,B cells,293T,U-937,Mouse kidney,Rat kidney
Cellular Location Cell membrane,Single-pass type I membrane protein
Purification Method Affinity purification
RRID AB_2757999