FCRL3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

FCRL3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-230110

Product Name FCRL3 Polyclonal Antibody
Application WB;IHC
Application Key Western blotting
Calculated Mw 21kDa/22kDa/69kDa/77kDa/80kDa/81kDa
Cellular Location Cell membrane,Single-pass type I membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-720 of human FCRL3 (NP_443171.2).
Isotype IgG
Observed Mw 105kDa
Product Background This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Positive Samples Raji,B cells,293T,U-937,Mouse kidney,Rat kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence RRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.