PGLYRP1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PGLYRP1 Polyclonal Antibody

Product Name PGLYRP1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-196 of human PGLYRP1 (NP_005082.1).
Sequence QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Recommended Dilution WB
Calculated MW 21kDa
Observed MW 35kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples 293T,LO2,HL-60
Cellular Location Cytoplasmic granule,Secreted
Purification Method Affinity purification
RRID AB_2758009